KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1675Help
Entry
NMBM01240149_1675 CDS       T01930                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00550  Peptidoglycan biosynthesis
nmm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBM01240149_1675
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMBM01240149_1675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
    NMBM01240149_1675
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nmm03036]
    NMBM01240149_1675
Enzymes [BR:nmm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBM01240149_1675
Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NMBM01240149_1675
Chromosome and associated proteins [BR:nmm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    NMBM01240149_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ADY98229
LinkDB All DBs
Position
complement(1845348..1847093)
Genome map
AA seq 581 aa AA seqDB search
MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQ
GDNRIVRTQTLPATRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELVDV
PVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIG
FTDIDGKGQEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLD
QRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNR
AVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQ
KSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSF
GYGLQLSLLQLARAYTALTHDGVLLPVSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEP
GGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA
HGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaagagtgaatataagccccggatgctgcccaaagaagagcaggtcaaaaag
ccgatgaccagtaacggacggatcagcttcgtcctgatggcaatagcggtcttgtttgcc
ggtctgattgcccgcggactgtatctgcagacggtaacgtataactttttgaaagaacag
ggcgacaaccggattgtgcggactcaaacattgccggctacacgcggtacggtttcggac
cggaacggtgcggttttggcgttgagtgcgccgacggagtccctgtttgccgtgcctaaa
gagatgaaggaaatgccgtctgccgcacaattggaacgcctgtccgagcttgtcgatgtg
ccggttgatgttttgaggaacaagctcgaacagaaaggcaagtcgtttatctggattaag
cggcagctcgatcccaaggttgccgaagaggtcaaagccttgggtttggaaaactttgta
tttgaaaaagaattaaaacgccattacccgatgggcaacctgtttgcacacgtcatcgga
tttaccgatattgacggcaaaggtcaggaaggtttggaactttcgcttgaagacagcctg
catggcgaagacggcgcggaagtcgttttgcgggaccggcagggcaatattgtggacagc
ttggactccccgcgcaataaagccccgaaaaacggcaaagacatcatcctttccctcgat
cagaggattcagaccttggcctatgaagagttgaacaaggcggtcgaataccatcaggca
aaagccggaacggtggtggttttggatgcccgcacgggggaaatcctcgccttggccaat
acgcccgcctacgatcccaacaggcccggccgggcagacagcgaacagcggcgcaaccgt
gccgtaaccgatatgatcgaacccggttcggcaatcaaaccgtttgtgattgcgaaagca
ttggatgcgggcaaaaccgatttgaacgaacggctgaatacgcagccttataaaatcgga
ccgtctcccgtgcgcgatacccatgtttacccctctttggatgtgcgcggcatcatgcag
aaatcgtccaacgtcggcacaagcaaactgtctgcgcgtttcggtgccgaagaaatgtat
gacttctatcatgagttgggcatcggtgtgcgtatgcactcgggctttccgggcgaaact
gcaggtttgttgagaaattggcgcaggtggcggcccatcgaacaggcgacgatgtctttc
ggttacggcctgcaattgagcctgctgcaattggcgcgcgcctataccgcactgacgcac
gacggcgttttgctgccggtcagctttgaaaaacaggcggttgcgccgcaaggcaaacgc
atattcaaagaatcgaccgcgcgcgaggtacgcaatctgatggtttccgtgaccgagccg
ggcggcaccggtacggcgggtgcggtggacggtttcgatgtcggcgcgaaaaccggcacg
gcgcgcaagttcgtcaacgggcgttatgccgacaacaaacacatcgctacctttatcggt
tttgcccccgccaaaaacccccgtgtgattgtggcggtaaccattgacgaaccgactgcc
cacggttattacggcggcgtagtggcagggccgcccttcaaaaaaattatgggcggcagc
ctgaacatcttgggcatttccccgaccaagccactgaccgccgcagccgtcaaaacaccg
tcttaa

DBGET integrated database retrieval system