KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1748Help
Entry
NMBM01240149_1748 CDS       T01930                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00061  Fatty acid biosynthesis
nmm00780  Biotin metabolism
nmm01100  Metabolic pathways
nmm01130  Biosynthesis of antibiotics
nmm01212  Fatty acid metabolism
Module
nmm_M00083  Fatty acid biosynthesis, elongation
nmm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMBM01240149_1748
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMBM01240149_1748
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NMBM01240149_1748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nmm01004]
    NMBM01240149_1748
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NMBM01240149_1748
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NMBM01240149_1748
Lipid biosynthesis proteins [BR:nmm01004]
 Fatty acid synthase
  Component type
   NMBM01240149_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADY98298
LinkDB All DBs
Structure
PDB: 

Position
complement(1921020..1921805)
Genome map
AA seq 261 aa AA seqDB search
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNAAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgcaaggcaaaaaaattctgattaccggcatgatttccgagcgttccatc
gcttacggcatcgccaaagcctgccgcgaacaaggcgcggaactggcgtttacctacgtt
gtggacaaactggaagagcgcgtccgcaaaatggcggcggaattggattccgaactcgtg
ttccgctgcgatgtcgccagcgacgacgaaatcaaccaagtgttcgccgatttgggcaaa
cattgggacggcttggacggtttggtgcattccatcggttttgcgccgaaagaagccttg
agcggcgacttcctcgacagcatcagccgcgaagcgttcaacaccgcacacgaaatttcc
gcatacagcctacctgcgctggcaaaagccgcccgtccgatgatgcgcggcagaaactcc
gccatcgtcgccctgagctacttgggcgcggtgcgcgcgattccgaactacaacgtgatg
ggtatggcaaaagccagccttgaggcaggcatccgctttaccgccgcctgtttgggcaaa
gaaggcatccgctgcaacggtatttccgccggtccgatcaaaacactcgccgcctccggc
atcgccgatttcggcaaactcttgggacacgtcgccgcccacaatccgctgcgccgcaac
gttaccatcgaagaagtcggcaatgccgccgccttcctgctgtccgacctgtcgtccggc
attaccggcgaaatcacttacgttgacggcggttacagcatcaatgccttgagcaccgag
ggataa

DBGET integrated database retrieval system