KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0415Help
Entry
NMCC_0415         CDS       T00633                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01130  Biosynthesis of antibiotics
nmn01230  Biosynthesis of amino acids
Module
nmn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMCC_0415 (aroK)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NMCC_0415 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 TsaE AAA AAA_22 PduV-EutP Cytidylate_kin AAA_5
Motif
Other DBs
NCBI-ProteinID: ABX72620
UniProt: A9M1U5
LinkDB All DBs
Position
complement(427836..428348)
Genome map
AA seq 170 aa AA seqDB search
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPTIFEMEGEQGF
RSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYLHAPPETLLERTRCDNS
RPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQTLLKRLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttaacggcaaactcatcctcatcggactgatgggcgcgggcaaaaccacg
ctgggccggcaaatggcgcagcggctggattaccgtttttacgacagcgatcacgaaatc
gccgcagccgccggcgttcccatccccaccatatttgaaatggaaggcgaacagggattc
cgttcgcgcgaaaccgccatactcaaaaagctggttatcctgccccatatcgtcctgtcc
accggcggcggcgcggtgttaaaagaagaaaaccgcgcccttatccgcaaaagcggcacg
gtcgtctatctgcacgccccgcccgaaaccctgctcgaacgcacgcgctgcgacaacagc
cgtcctttgctgcaagttgccgatcctttggcgaaattacgtgaactctacgccgcacgc
gaccccgtttaccgccaaaccgccgactttaccgtagaatcggcaaactgccgggaaacc
gtgcaaaccctgctcaaacgcttatcccgataa

DBGET integrated database retrieval system