KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0421Help
Entry
NMCC_0421         CDS       T00633                                 

Gene name
ponA
Definition
(GenBank) penicillin-binding protein 1
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00550  Peptidoglycan biosynthesis
nmn01100  Metabolic pathways
nmn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMCC_0421 (ponA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMCC_0421 (ponA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nmn01003]
    NMCC_0421 (ponA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
    NMCC_0421 (ponA)
Enzymes [BR:nmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NMCC_0421 (ponA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMCC_0421 (ponA)
Glycosyltransferases [BR:nmn01003]
 Polysaccharide
  Bacterial polysaccharide
   NMCC_0421 (ponA)
Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NMCC_0421 (ponA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABX72626
UniProt: A9M1V1
LinkDB All DBs
Position
434976..437306
Genome map
AA seq 776 aa AA seqDB search
MVAIAILVTYPKLPSLDSLQHYQPKMPLTIYSADGEVIGMYGEQRREFTKIGDFPEVLRN
AVIAAEDKRFYRHWGVDVWGVARAAVGNVVSGSVQSGASTITQQVAKNFYLSSEKTFTRK
FNEVLLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLA
GLPKAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQS
ALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAE
NYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALG
FAARAVNNEKMGEDRIRRGAVIRVKNNGGRWAVVQEPLLQGALVSLDAKTGAVRALVGGY
DFHSKTFNRAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGKGPNGSVWTPK
NSDGRYSGYITLRQALTASKNMVSIRILMSIGVGYAQQYIRRFGFRSSELPASLSMALGT
GETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRDGRLRAQMQPLVAGQNAPQAIDPRNAY
IMYKIMQDVVRVGTARGAAALGRTDIAGKTGTTNDNKDAWFVGFNPDVVTAVYIGFDKPK
SMGRVGYGGTIAVPVWVDYMRFALKGKQGKGMKMPEGVVSSNGEYYMKERMVTDPGLTLD
NSGIAPQPSRRAKEDDGGAAEGGRQAADDEVRQDMQETPVLPSNTGSKQQQLDSLF
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
ttggttgccattgctattttggtaacgtatccgaaactgccgtctttggattctttgcag
cattaccagcctaaaatgccgttgactatttattcggcggatggggaagtcatcggtatg
tatggggagcagcggcgcgaatttacaaaaatcggcgatttcccagaggtgttgcggaat
gcggttatcgccgccgaggacaaacgcttttaccggcattggggggtggatgtttggggt
gttgcccgcgctgccgtcggcaatgtcgtgtccggcagcgtgcagtcgggtgcgagtacg
attacgcagcaggtggcgaaaaatttttatttgagcagtgaaaaaacgttcacacgcaaa
ttcaatgaggtgttgcttgcctataaaatcgagcagtctttaagcaaagacaaaatcctc
gagttgtatttcaatcagatttacctcggtcagcgcgcctatggttttgcatctgccgcg
caaatctatttcaataagaatgtccgagatttgactttggcggaagccgccatgcttgcg
ggactgcccaaggctccgtctgcctataatccgattgttaatccagaacgtgccaagttg
cgccagaagtatattttgaacaatatgctcgaggagaagatgattaccgtgcaacagcgc
gatcaggcgttgaatgaggaactgcattacgagcggtttgttcggaaaatcgatcagagt
gctttatatgtggcggaaatggtgcgtcaggaactgtatgagaaatacggtgaagatgcc
tatacgcagggttttaaggtttataccacggtccgcgccgatcatcagaaggtggcaacc
gaggcattgcgcaaggctctacggaatttcgatcgcggcagcagctaccgcggtgcggaa
aactatatcgatttgagtaagagtgaagatgtcgaggagactgtcagccagtatctgtcg
ggactctataccgtcgataaaatggttcccgccgttgtgttggatgtgactaaaaagaaa
aatgtcgtcatacagctgcccggcggcaggcgggttacgcttgacaggcgcgccttgggt
tttgcggcccgcgcggtcaataatgaaaaaatgggggaggaccgtatccgcaggggcgcg
gtcatccgtgtcaaaaacaacggcgggcgttgggcggtggttcaagagccgttgctgcag
ggggctttggtttcgctggatgcaaaaaccggagctgtgcgcgcgctggtcggcggttat
gattttcacagcaaaacattcaatcgtgccgttcaggcaatgcggcagccgggttcgacc
tttaagccgtttgtctattcggcggcattatctaaggggatgaccgcgtccacagtggtt
aacgatgcgccgatttccctgccggggaaagggccgaacggttcggtttggacacctaaa
aattcagacggcagatattccggctacattactttgagacaggctctgacggcttccaag
aatatggtttccatccgtattttgatgtctatcggtgtcggttacgcgcaacagtatatc
cggcgtttcggcttcaggtcgtccgagctgccggcaagcctgtctatggctttaggtacg
ggcgagacaacgccgttgaaagtggcggaggcatatagcgtatttgcgaacggcggatat
agggtttcttcgcacgtaatcgataagatttatgacagagacggcaggttgcgcgcccaa
atgcaacctttggtggccgggcaaaatgcgcctcaggcaatcgatccgcgcaatgcctat
attatgtataagattatgcaggatgtggtccgtgttggtacggcaaggggggcagctgcg
ttgggaagaacggatattgccggtaaaacgggtacgaccaatgacaataaggatgcgtgg
tttgtcggttttaaccctgatgtggttactgccgtatatatcggcttcgacaaacctaag
agtatggggcgtgtcggctacggcggtacgattgcggtgccggtttgggtggactatatg
cgttttgcgttgaaaggaaagcagggcaaggggatgaaaatgcctgaaggtgtggtcagc
agcaatggcgaatactatatgaaggaacgtatggtaaccgatccgggcttgacgctggac
aacagcggtattgcgccgcaaccttcccgacgggcaaaagaagatgacgggggcgcggca
gaaggcggacggcaggcggcggatgacgaagtccgccaagatatgcaggaaacgccggtg
cttccgagtaatactggttccaaacagcagcagttggattctctgttttaa

DBGET integrated database retrieval system