KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0431Help
Entry
NMCC_0431         CDS       T00633                                 

Gene name
pbp3
Definition
(GenBank) Penicillin-binding protein 3
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMCC_0431 (pbp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nmn01002]
    NMCC_0431 (pbp3)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
    NMCC_0431 (pbp3)
Enzymes [BR:nmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMCC_0431 (pbp3)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     NMCC_0431 (pbp3)
Peptidases [BR:nmn01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   NMCC_0431 (pbp3)
Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NMCC_0431 (pbp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABX72636
UniProt: A9M1W1
LinkDB All DBs
Position
complement(447082..448629)
Genome map
AA seq 515 aa AA seqDB search
MRLNHFIMIAIIIYVISPANKPARRHSVPTYPALPYNCFFYVTDLPMNFPKTAASLLLLL
ASLAAHALDTGRIPQNEIAVYVQELDSGKVIIDHRSDVPVNPASTMKLVTAFAAFKTFGS
NYRWATEFKSNGTVNDGTLDGNLYWAGSGDPVFNQENLLAVQRQLREQGIRNITGHLMLD
HSLWGEVGSPDDFEADSGSPFMTPPNPTMLSAGMVMVRAERNAADSTDILTDPPLPHIFA
QNNLKITASQAACPSIKKLMRASFSDNTLKLRGNIPESCLGKPVGVRMFALDELIRQSFT
NHWLLGGGRISDGIGISDTPEGAQTLAVAHSKPMKEILTDMNKRSDNLIARSVFLKLGGN
GKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGLSRKERVTARMMAQMLETAYFSPFA
QDFIDTLPIAGTDGTLRNRFKQSGGLLRLKTGTLNNVRALAGYWLGDKPMAVVVIINSGR
AVSLLPDLDNFVANNIISGGDGWLDAKLMCKERRA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctcaatcatttcataatgatagcgattattatatatgtgatttcccctgcaaac
aagccggcccgccgccacagcgttcccacttatccggctttgccttataattgctttttt
tatgtaacagatttacctatgaatttccccaaaacagcggcctccctgctgctgcttctc
gcctccctcgccgcacacgcgctcgatacgggtcgcattccgcaaaacgaaatcgccgta
tatgtccaagagcttgacagcggaaaagtcatcattgaccaccgctcggatgtccccgtc
aaccccgcctccacaatgaaactcgttaccgcgtttgccgccttcaaaaccttcggcagc
aattaccgctgggcgaccgagtttaaaagcaacggtacggtaaacgacggcacgcttgac
ggaaacctgtattgggcgggcagcggcgaccccgttttcaatcaggaaaacctgcttgcc
gtccaacgccagttgcgcgaacaaggcatacgcaatatcacgggacacctgatgctcgac
cacagcctgtggggcgaagtcggcagccccgacgatttcgaagccgacagcggttcgccg
tttatgacgccccccaatccaactatgctgtctgccggtatggttatggtgcgcgccgaa
cgcaatgccgccgacagtaccgacatcctcaccgatccgcctttgccgcatattttcgcc
caaaacaacttgaaaattaccgcctcccaagctgcctgcccttcgatcaaaaaactgatg
cgtgcatctttttcggacaatacgctgaaattgcgcggcaatattcccgagagctgtttg
ggcaagcctgtcggtgtccggatgttcgcgcttgacgaactgatccggcaaagttttacc
aaccactggctgctcggcggcggacggatttcagacggcatcggcatatccgacacgccg
gaaggcgcgcagacgcttgccgttgcacactcaaagccgatgaaggaaattttgacggac
atgaacaagcgttcggacaatctaattgcgcgttccgtcttcctcaaactcggcggcaac
ggcaaactgcccgccgtttccgaacaggcagcgtctgccgtccggcgtgaacttgccgtg
tcgggcatcgatgttgcggatttggttttggaaaacggttcaggtctgtctagaaaagaa
agggtaacggcgagaatgatggcgcaaatgttggaaacggcttatttcagcccgtttgca
caagatttcatcgatacgctgcccatcgccggcacagacgggactttacgcaaccgcttc
aaacaaagcggcgggctgttgcgcttaaaaaccggcacgctcaacaatgtccgcgccctt
gcaggttattggctgggcgacaaaccgatggcggtggtcgtcatcatcaacagcggccgc
gccgtttccctgctgcccgacttggacaacttcgttgccaacaacatcatctccggcggc
gatggctggctggatgcgaaactgatgtgcaaagaacgccgagcctga

DBGET integrated database retrieval system