KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0539Help
Entry
NMCC_0539         CDS       T00633                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding_2 Acetyltransf_3 Acetyltransf_4 Acetyltransf_1 Succ_CoA_lig FR47 GNAT_acetyltran TYW3 CoA_binding Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: ABX72738
UniProt: A9M2D4
LinkDB All DBs
Position
complement(562331..564757)
Genome map
AA seq 808 aa AA seqDB search
MSAQTDPGYFFMPNHIILIGASERPYSLGERVLSNLLSTPFQGKITPVNPRHHTIAGLPA
YTSLNKIPGSADLIIAVTLPDSYDTLFKTCRKKQLRHIILIQDWDSLPAAELHTAETAIR
KHHGNGLNITACTTAGIQLPSLGLNISTQDGYAAGHTAILTGNAAVSRQIDNILNKLRQG
TSRHISLHPGISPITSSDWLNRFGHSLHTKTAVLHHNPEEDQRKLFSAIRQFTRHTPLIL
HITCRTTETDRAVLHCLARHCNFLISFNADDLEAALRAQLSDLPPLSRLDILSDTPAEWL
NAHAPKTLALHFPNLPHHIRNGHLTGTPTPSICHDIASRQLARPDTQAVLTILSPSGHED
YKKTARALIRLSEQTAKPLLVSSPFSDGITHFDTPTQAIRTLSYRNTAAALKQAQLDIAP
PQPCRLKTPQPQNIKKALEAADPALLAEALHLPPYRHTTHNAVQFQFGSHPLYGDILTAC
CNGQTTAVLPPFTTLDSRHLARFAELDGTQTLDQFLHTLTVIPEYRQHILGITLNLNGGQ
YSSDFILKTPETHDTPKRKNTGKAAQTLEHAAAKMQSAAAYLKHKNPTAAEFLRHTSEAA
AELLGSKTETGAAVPNVLAPYPAAHLKTLSLKNNTTVTITPLLPEDAEAKQQFVRSLSPE
ARYTRFMTHTNELPAATLARLCNPDYHCEAAWTARDADSNIVAVVRHSRLNRNECEFGIT
LAEHMRGSGLAQKMMELIIQTAAQQGYRTMSADILKTNTPMIKLAEKSGFTLKESDTEKN
LYRAYLNLAADKTTEKTNKNLRTDHKIT
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacaaaccgatccgggctactttttcatgcccaaccacattattctgataggc
gcgagcgaacgtccgtacagcctgggcgaacgcgtactcagcaacctgctgagtacgccc
tttcaaggaaaaatcacccccgtaaacccgcgccaccacaccatagccgggcttcccgcc
tacaccagcctcaacaaaatccccggcagtgcagacctgattattgccgttaccctaccc
gacagttacgacaccctcttcaaaacctgccgcaaaaagcagctccgacacatcatcctc
atacaggactgggacagcctgcctgccgcagaactgcacaccgccgaaactgccatccgc
aaacaccacggcaacggactcaacatcaccgcctgcaccaccgcaggcatccaactgccc
tcactcggacttaacatcagtacccaagacggatacgccgcaggccataccgccatactg
accggcaatgccgccgtcagccgccaaatcgacaacatcctgaacaaactccgtcaaggc
acatcccgccacatcagcctgcatcccggcatcagccccatcacttcctcagactggctc
aaccgcttcggacacagcctgcacaccaaaaccgccgtcctacaccacaaccctgaagag
gatcagcgcaaactgttcagcgcaatccgccaatttacccgccatacgccgctgattctc
cacatcacctgccgcacgacagaaaccgaccgtgccgtactgcactgcctcgcccgacac
tgcaacttcctcatcagtttcaacgccgacgaccttgaagccgcactgcgcgcccaactg
tccgaccttccacccctgtcccgactcgacatcctgtccgacacgcctgccgaatggctg
aacgcgcacgcgccaaaaaccctcgccctccactttcccaaccttccccaccacatccgc
aacggacacctgaccggcacacccacaccctcaatctgccacgacatcgcctcacgtcag
cttgcccgccccgacacccaagccgtcctgaccatcctcagcccctccggacacgaggat
tacaaaaaaacagcacgcgcccttatccgcctgtccgaacagaccgccaaacccctgctc
gtcagcagccccttttcagacggcataacccatttcgacacccccactcaggcaatccgc
accctttcctaccgcaacaccgccgccgccctgaaacaggcacagctcgacattgcaccg
ccgcaaccgtgccgtctgaaaacaccgcaaccccaaaacatcaaaaaagccctcgaagcc
gccgaccccgccctgctcgccgaagccctgcacctccccccctaccggcacactacccat
aacgccgtccaattccaattcggcagccaccccctctatggcgacatcctgaccgcatgc
tgcaacggacaaaccactgccgtactcccgccgtttaccacgctcgacagccgccacctt
gcccgctttgccgaactcgacggcacacaaaccctcgaccagttcctgcacacactgacc
gtcattcccgaataccgccaacacattctcggcatcaccctcaacctcaacggcggacaa
tacagcagcgatttcatcttaaagacacccgaaacacacgacacgcccaaacgcaagaac
acaggcaaagccgcccaaaccctcgaacatgccgccgcaaaaatgcagagtgccgccgca
tacctgaaacacaaaaacccgacagccgccgaatttctccgccacacaagcgaagccgcc
gcagaactgctcggcagcaaaaccgaaaccggagcagccgtacccaacgtacttgccccc
tatcccgcagcacacctcaaaacactgtccctaaaaaacaacacgaccgttaccattacc
ccccttttgcccgaagacgcagaagccaaacagcagttcgtccgcagcctcagccccgaa
gcacggtacacacgcttcatgacccacaccaacgaactgcccgcagccacgttggcacgc
ctgtgcaaccccgactaccactgtgaagccgcatggacggcaagggatgccgacagcaac
atcgtcgccgtcgtccgccacagccgcctgaaccgcaacgaatgcgaattcggcatcaca
ctggcggaacatatgcgcggcagcggactggcacagaaaatgatggaactcatcatccaa
accgccgcacagcaaggctaccggactatgagtgccgacattctcaaaaccaatactccc
atgatcaaacttgctgaaaaatcaggatttaccctcaaggaatcggacaccgaaaaaaac
ctgtaccgcgcatatctgaaccttgcggcagacaaaacaacagaaaaaacaaataaaaac
ttgcgcaccgaccacaaaataacctaa

DBGET integrated database retrieval system