KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0551Help
Entry
NMCC_0551         CDS       T00633                                 

Definition
(GenBank) histone deacetylase family protein
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl Phenol_hyd_sub
Motif
Other DBs
NCBI-ProteinID: ABX72750
UniProt: A9M2E6
LinkDB All DBs
Position
complement(573999..575108)
Genome map
AA seq 369 aa AA seqDB search
MSLTRLILKFYALLRLFLGKNARTAWISHPACTGHEPGANHPDSPDRILCIEQALRRAGI
WQHLQTIEAEEISDTRLALVHSSKYLNRLESCLPQKGKIFRLDNDTAISTGSLSAAHFAA
GSAVQAVDMVMNRKAWHAFCAARPPGHHAGSGKAGGFCLLNNVAAGVMHAIAEYRLKRIA
VIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFPFPENNDMPDGGNMVHLPLPPGTGSRT
FREAVRRQWLPRLAAFKPELVLLSAGFDAHRLDESGRLNLHEADFAWLTHKIIQTASGCP
GKIVSVLEGGYTLEPLAQSAAEHIRVLAGLGKSDAATAYQKTLDPTKKRFAKPKTGQVRQ
PTQSDRYDI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacccgcctaatcttgaaattctatgcactgttgcgcctttttttgggcaaa
aacgcccgcaccgcatggatttcgcatcccgcctgcaccgggcacgaacccggcgcaaac
catcccgattcgcccgaccgcatcctctgcatcgagcaggcattgcgccgcgccggtatt
tggcagcacctccaaaccatagaggcggaagaaatcagcgatacgcgcctcgcacttgtc
cactcgagcaaatatctgaaccgtttggaatcttgcctgccccaaaaaggcaagattttc
cgcctggataacgacactgcaatcagcacaggctcgctgtctgccgcacactttgccgcc
ggttcggcagttcaggcagtcgacatggtcatgaaccgtaaagcatggcatgccttttgc
gccgcccgcccgcccggacaccatgcgggcagcggcaaagccggcggattctgcctgctg
aacaacgttgccgccggcgtcatgcatgccattgccgaataccgcctgaaacgcattgcc
gtcatcgatttcgatgtccactacggcgacggtacggcagaaatattcaaagacgatccg
cgcatcctgtttttcaacctgtttgaaaccgaccttttccccttccccgaaaacaacgat
atgcccgacggcggcaatatggtgcacctgcccttgccgccgggaacgggcagccgcaca
ttccgcgaagccgtccgcagacagtggctgccccggcttgccgcattcaaacccgaactg
gtgctgctgtcggcaggattcgacgcacaccgtctggacgaatcgggcaggctcaacctg
cacgaggcggattttgcctggctgacacacaaaatcattcagacggcatcgggctgcccc
ggcaaaatcgtatccgtactcgaaggcggctacacccttgaacctctggcacaatctgct
gccgagcatatccgcgtgctggcggggctgggcaaatccgatgccgcaaccgcctatcag
aaaacactggatccaacaaaaaaacggtttgccaaaccgaaaaccggacaggtgcgccaa
cctacccaatccgaccgttacgacatatag

DBGET integrated database retrieval system