KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0552Help
Entry
NMCC_0552         CDS       T00633                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03210  preprotein translocase subunit YajC
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn02024  Quorum sensing
nmn03060  Protein export
nmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NMCC_0552
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NMCC_0552
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NMCC_0552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nmn02044]
    NMCC_0552
Secretion system [BR:nmn02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NMCC_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 T2SSM
Motif
Other DBs
NCBI-ProteinID: ABX72751
UniProt: A9M2E7
LinkDB All DBs
Position
575236..575502
Genome map
AA seq 88 aa AA seqDB search
MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKVGDKVVLAAGFKGKVTRVG
EQFFTVDIGQGTKIEVEVERNAIAAKVD
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagctgttgcacaatttgctcctttagtgttgattatggtggtgttctacttc
ctgatcatgcgtccgcagcaaaagaaattcaaagcgcatcaggcaatgcttgccgccttg
aaagtcggcgacaaagtggtcttggcggcaggtttcaagggtaaggtaaccagagtcggc
gaacagttttttaccgtggatatcggacagggtacaaaaatcgaggtcgaagtagaacgc
aatgcgattgccgcaaaagtcgattga

DBGET integrated database retrieval system