KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0554Help
Entry
NMCC_0554         CDS       T00633                                 

Gene name
secF
Definition
(GenBank) protein-export membrane protein
  KO
K03074  preprotein translocase subunit SecF
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn03060  Protein export
nmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NMCC_0554 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NMCC_0554 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nmn02044]
    NMCC_0554 (secF)
Secretion system [BR:nmn02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NMCC_0554 (secF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG PET117
Motif
Other DBs
NCBI-ProteinID: ABX72753
UniProt: A9M2E9
LinkDB All DBs
Position
577571..578506
Genome map
AA seq 311 aa AA seqDB search
MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVTKGLNFSVEFTGGTVMEVQYQQGAD
VNKMRERLDTLKIGDVQVQALGTNKHIMIRLPNKEGVTSAQLSNQVMDLLKKDSPDVTLR
QVEFIGPQVGEELVSNGLMALGFVVIGIIIYLSMRFEWRFAVSAIIANMHDIVIILGCFA
FFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRKPAMRGHAVPEVIDNAITATMSR
TIITHGSTEAMVVSMLVFGGTALHGFSMALTIGIVFGIYSSVLVASPLLLMFGLSRDNIG
KEPKKKEEIVV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaactctttaaaatcaaacgcgatattccgtttatgagctacggcaaactgacgacc
ttcatttcgttggttacgtttatcgctgccgtgttcttcttggtgaccaaaggcctgaat
ttctctgtcgaatttaccggcggtacggtaatggaagtccaatatcagcagggtgcggat
gtcaataagatgcgcgaacgcctcgatacgctgaaaataggtgatgtacaggttcaggca
ttgggtacgaacaaacacatcatgatccgcctgccgaacaaagaaggtgttacttccgca
cagttgtccaatcaggttatggatttgctgaaaaaagacagtcccgacgttaccttgcgc
caagtcgaatttatcggcccgcaagtcggtgaggaattggtaagtaatggattgatggct
ttaggttttgtcgttatcggcatcattatttacctgtcgatgcgttttgaatggcgtttt
gccgtatctgccattatcgccaatatgcacgacatcgtgattattctcggctgctttgcc
ttcttccaatgggaattttcgctgaccgtcttggcgggtatccttgccgtattgggctat
tctgtgaacgaatccgtcgtcgtcttcgaccgtatccgtgaaaacttccgcaagccggcg
atgcgcggacatgccgtgccggaagtcatcgacaacgcgattaccgcaacgatgagccgc
accatcattacccacggttcgaccgaggcgatggtcgtatccatgctggtgttcggcggt
acggccttgcacggcttttctatggcgttgaccatcggcatcgtgttcggcatttattct
tccgtattggttgccagcccgcttctgctaatgttcggtttgagccgcgacaatatcggt
aaagaaccgaagaagaaagaagaaatcgtggtttga

DBGET integrated database retrieval system