KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1077Help
Entry
NMCC_1077         CDS       T00633                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NMCC_1077
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     NMCC_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin Glt_symporter HK
Motif
Other DBs
NCBI-ProteinID: ABX73257
UniProt: A9LZ80
LinkDB All DBs
Position
1059185..1060033
Genome map
AA seq 282 aa AA seqDB search
MLQTALRFPYVFKARAEDSHKGTFGTLAVVGGSAGMSGAPVLAASAAMYLGCGKVWAGFN
QDALPFAVIAGFPEIMLDTADGLSKRQDINAWVVGCGLGTGRAAVGTLAGILTEHTDKPV
LLDADALNILSTDAETRNLARGCKNLILTPHPAEAARLLGTTVAQVQADRTAAVRKIGAI
FGATVVLKGHKTLVAASDTEIYVNESGNAGLATAGSGDVLGGIIGSLLAQGVPVFEAACA
GAWLHGAAADVIKESAGIAAGLLAGEIAPAARWLRNRITESM
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagacggcattgcgttttccctatgttttcaaagcccgtgcggaagattcgcac
aaagggactttcggcacgctcgccgtagtcggcggatcggcagggatgagcggtgcgccc
gtattggcggcatcggcggcgatgtatctcggctgcggcaaggtgtgggcgggtttcaat
caggatgcgctaccttttgccgttattgccggttttcccgagattatgctggatacggca
gacggtttgagcaagcgtcaagatataaacgcctgggttgtcggttgtggattgggtaca
ggtagggcggcggtcggaacgcttgccggaattttgacggaacacacggacaagcccgtc
cttttggatgcggacgcgctgaacatattatcaaccgatgccgaaacccgaaatctggca
cgcgggtgtaaaaacctgattttaacgccacaccccgccgaagccgcgcgcctgcttgga
acgacggttgcacaggttcaggcggatcggacggcggcagtgaggaagataggggcaatt
ttcggcgcaaccgtggttttaaaggggcacaaaacattggttgccgcgtccgatacggaa
atctatgtcaacgaaagtggcaacgcgggattggcaacggcgggcagtggcgacgtattg
ggcggcatcatcggcagtctgctcgcacagggcgtgccggtttttgaagccgcctgcgcg
ggcgcgtggctgcacggcgcggcggcggatgtcataaaagaatcggcaggcattgcggca
gggctgttggctggcgaaatcgccccggcggcaaggtggctgcgtaaccggataactgaa
agtatgtaa

DBGET integrated database retrieval system