KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1731Help
Entry
NMCC_1731         CDS       T00633                                 

Gene name
penA
Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00550  Peptidoglycan biosynthesis
nmn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMCC_1731 (penA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMCC_1731 (penA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
    NMCC_1731 (penA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nmn03036]
    NMCC_1731 (penA)
Enzymes [BR:nmn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMCC_1731 (penA)
Peptidoglycan biosynthesis and degradation proteins [BR:nmn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NMCC_1731 (penA)
Chromosome and associated proteins [BR:nmn03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    NMCC_1731 (penA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABX73874
UniProt: A9M2I2
LinkDB All DBs
Position
complement(1776641..1778290)
Genome map
AA seq 549 aa AA seqDB search
MAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTVSDRNGAVLALSAPT
ESLFAVPKEMKEMPSAAQLERLSELVDVPIDVLRNKLEQKGKSFIWIKRQLDPKVAEEVK
ALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLHGEDGAEVVLRD
RQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDART
GEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNERL
NTQPYKIGPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIGVRM
HSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPVSFEKQ
AVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGFDVGAKTGTARKFVNGRYADN
KHIATFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGPPFKKIMGGSLNILGISPTKPL
TAAAVKTPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagcggtcttgtttgccggtctgattgcccgcggactgtatctgcagacggta
acgtataactttttgaaagaacagggcgacaaccggattgtgcggactcaaacattgccg
gctacacgcggtacggtttcggaccggaacggtgcggttttggcgttgagtgcgccgacg
gagtccctgtttgccgtgcctaaagagatgaaggaaatgccgtctgccgcacaattggaa
cgcctgtccgagcttgtcgatgttccgattgatgttttgaggaacaagctcgaacagaaa
ggcaagtcgtttatctggattaagcggcagctcgatcccaaggttgccgaagaggtcaaa
gccttgggtttggaaaactttgtatttgaaaaagaattaaaacgccattacccgatgggc
aacctgtttgcacacgtcatcggatttaccgatattgacggcaaaggtcaggaaggtttg
gaactttcgcttgaagacagcctgcatggcgaagacggcgcggaagtcgttttgcgggac
cggcagggcaatattgtggacagcttggactccccgcgcaataaagccccgaaaaacggc
aaagacatcatcctttccctcgatcagaggattcagaccttggcctatgaagagttgaac
aaggcggtcgaataccatcaggcaaaagccggaacggtggtggttttggatgcccgcacg
ggggaaatcctcgccttggccaatacgcccgcctacgatcccaacaggcccggccgggca
gacagcgaacagcggcgcaaccgtgccgtaaccgatatgatcgaacccggttcggcaatc
aaaccgtttgtgattgcgaaagcattggatgcgggcaaaaccgatttgaacgaacggctg
aatacgcagccttataaaatcggaccgtctcccgtgcgcgatacccatgtttacccctct
ttggatgtgcgcggcatcatgcagaaatcgtccaacgtcggcacaagcaaactgtctgcg
cgtttcggtgccgaagaaatgtatgacttctatcatgagttgggcatcggtgtgcgtatg
cactcgggctttccgggcgaaactgcaggtttgttgagaaattggcgcaggtggcggccc
atcgaacaggcgacgatgtctttcggttacggcctgcaattgagcctgctgcaattggcg
cgcgcctataccgcactgacgcacgacggcgttttgctgccggtcagctttgaaaaacag
gcggttgcgccgcaaggcaaacgcatattcaaagaatcgaccgcgcgcgaggtacgcaat
ctgatggtttccgtgaccgagccgggcggcaccggtacggcgggtgcggtggacggtttc
gatgtcggcgcgaaaaccggcacggcgcgcaagttcgtcaacgggcgttatgccgacaac
aaacacatcgctacctttatcggttttgcccccgccaaaaacccccgtgtgattgtggcg
gtaaccattgacgaaccgactgcccacggttattacggcggcgtagtggcagggccgccc
ttcaaaaaaattatgggcggcagcctgaacatcttgggcatttccccgaccaagccactg
accgccgcagccgtcaaaacaccgtcttaa

DBGET integrated database retrieval system