KEGG   Natronomonas moolapensis: Nmlp_1851Help
Entry
Nmlp_1851         CDS       T02478                                 

Gene name
glpA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nmo  Natronomonas moolapensis
Pathway
nmo00564  Glycerophospholipid metabolism
nmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nmlp_1851 (glpA2)
Enzymes [BR:nmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Nmlp_1851 (glpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Pyr_redox_2 FAD_binding_2 Pyr_redox 3HCDH_N NAD_binding_8 HI0933_like ApbA Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CCQ36039
UniProt: M1Y0P2
LinkDB All DBs
Position
complement(812393..813622)
Genome map
AA seq 409 aa AA seqDB search
MSADPTVLVIGGGATGTGIARDLALRGVDVTLVERGGLGSGTSGRSHGLLHSGARYAESD
ASGAAECLAESRTLREIAGACVRETGGLFVRLEGDDAAYFETKLAACEETGIETERLDGD
AARDLVDGLSDAVVEAFRVPDGVVYPSRLVAANAADAAAHGADVHPHAPVEAIETGADGI
TAVDVGGSVDEHIEPTHVVNATGAWADRIAEMAGCTVGMAPSRGVMVSLEYDGLGPVLNR
CRDPDDGDIVLPHEGEVVVGTTSVPVSTPETYETAEWEIERSIEECAAMLPAVAEAPERR
TWWGVRPLYEPDEAAADRRGISRGFTILDHGDEGVSNLHSVVGGKLTTYREMAEVTADRV
CERLGVAEPCRTAEEPLVGADDPSRLDALVEQYGGPNPTDAGVVGTDGG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacccgaccgtcctcgtgatcggcggtggcgcgacgggaaccggaatcgcc
cgcgacctcgcgttgcggggagtagacgtgacgctcgtcgagcggggcgggttaggtagc
ggcacctccggccgatcgcacggactgttgcacagcggtgcccggtacgccgagtccgac
gcgtccggcgcggccgagtgtctcgccgaaagccgtaccctccgcgaaatcgccggtgct
tgtgtccgcgagacgggtgggctgttcgtccgactcgagggcgacgacgcggcgtacttc
gaaacgaaactggccgcctgcgaggagaccggcatcgaaaccgagcgcctggacggcgac
gcggcccgtgatctcgtggacgggctttccgatgcggtcgtcgaggcctttcgcgtcccg
gacggcgtcgtctacccgtcgcggctcgtggcggcaaacgcggccgacgcggcggcccac
ggggctgacgtgcacccacacgcgccggtcgaggcgatcgagaccggggcggacgggatc
accgcggtcgacgtcggtggaagcgtcgacgaacacatcgaaccgacccacgtcgtcaac
gcgaccggggcgtgggccgaccggatcgccgagatggccggttgtacggtcgggatggct
ccgagccgcggtgtgatggtttcactcgagtacgacgggctcgggccggtgttgaaccgg
tgtcgcgaccccgacgacggcgacatcgtcctgccccacgagggcgaagtcgtcgtgggc
accacgagcgtgcccgtctccacccccgaaacgtacgagaccgccgagtgggaaatcgag
cgctccatcgaggagtgtgccgcgatgcttcccgcggtcgccgaggcaccggagcgtcgg
acgtggtggggggtccgcccgctgtacgaacccgacgaggcggccgccgaccgccgtggc
atctcccgtgggtttaccatactcgatcacggcgacgagggcgtctcgaacctccacagc
gttgtcggcggaaagctgaccacgtaccgagagatggcggaggtgacggccgaccgcgtc
tgcgagcgcctgggcgtcgccgagccgtgtagaaccgccgaagaaccgcttgtcggagcc
gacgatccgagccgacttgacgcgctcgtcgagcagtacgggggaccgaacccgacggac
gctggcgtggtcgggacggacggcggttga

DBGET integrated database retrieval system