KEGG   Natronomonas moolapensis: Nmlp_1869Help
Entry
Nmlp_1869         CDS       T02478                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nmo  Natronomonas moolapensis
Pathway
nmo00620  Pyruvate metabolism
nmo00680  Methane metabolism
nmo00720  Carbon fixation pathways in prokaryotes
nmo01100  Metabolic pathways
nmo01120  Microbial metabolism in diverse environments
nmo01200  Carbon metabolism
Module
nmo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nmo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nmlp_1869 (ppc)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmlp_1869 (ppc)
   00680 Methane metabolism
    Nmlp_1869 (ppc)
Enzymes [BR:nmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nmlp_1869 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCQ36057
UniProt: M1XPQ6
LinkDB All DBs
Position
832190..834883
Genome map
AA seq 897 aa AA seqDB search
MRLHRRDIQRDIRELGAMLGDTIEAQESRAAFDTVERLRKRSVDRRSGGGDVGSIRTELD
DLDADRELVAASAFTTYFELINLAEERERIRALREQAQAGVPDDGLEEAADALAGNDAED
IASILEDVYIQPTFTAHPTEARRKTVKAKLRSVSSSLETLDERLLTDKEGGQVERELRAE
VTSLWQTPQIRQRRPEPTDEALNVQWYLENTLFDVVGEVYQELEDALAERSAFDAEQRVP
TLFEFRSWAGSDRDGNPYVTPEVTTATLSRQRRVVLEKYREELKRLSGVLSQDSDHVEIG
SEVDERLAHHEEALPSVSAEAEERYPDEPYRQLLRLMRERLDRVGTVRPGEYGHVDEFVA
DLDAIGDDLRSNAAGNVADVHVDPLRRQVETFGFTLASLDLRDHQENHTLAIEAALERQG
IDYAGLDETERVEFLTDAIAEDDPILEFDDLGELDETTERVLTRFERLADWQREYGTDAI
DTYCISMCEEPSHVLEVLFLADQVDVVDLPGHSGLDVVPLLETEYALSGARRIIGTLFEN
DAYAAALEARGGTQEVMLGYSDSCKENGFFAAQWSLQRNEKRLANICSDYGVDLRLFHGR
GGSISRGGGPMNDALLALPNETVTGEVKFTEQGEAIAEKYASPKIAERELEQMLNAQLRA
RQGAIERPTEPVEEEWIEAMETGAAAAREAYEDLLETEGFVAFFEQATPITVIENLNLGS
RPASRSGERTVEDLRAIPWVFAWTQARCIVPGWYSLATGLDAYLEDGGDIETLEEMYEAW
PFFRSMLDNAAIALAKTDMTIAAEYAALAEEDLRERIFTDIEAEYERAVGLVSEITGGDS
LPLSGWFEESLRRRNPYVDPLNLLQLRLLSRSERSEAERRALRMTVKGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgcgactacaccgtcgtgacatacagcgcgacatccgggagttgggggcgatgctcggc
gatacgatcgaagcgcaagaatcgcgggccgccttcgataccgtcgagcgcctccggaag
cggtcggtcgaccgacggagcggcggcggcgacgtcggatcgatccgaaccgaactcgac
gacctcgacgccgaccgtgaactcgtggccgcgagcgcgtttactacgtacttcgagttg
atcaacctcgcggaggagcgcgagcgaatcagggccctcagagagcaggcccaagccggc
gtcccggacgacggcctcgaggaagccgccgacgcgctcgccggcaacgacgccgaggac
atcgcctcgatactcgaggacgtctacatccagccgacgttcaccgcccacccgaccgag
gcccggcgcaagacggtgaaggcgaagcttcggtcggtgtcgtcgtcgctcgagacactc
gacgagcggctcctgaccgacaaagaaggtggacaggtcgaacgggaactccgcgccgag
gtgacgagtctctggcagaccccccagatccgccagcgacggccggagccgaccgacgag
gcgttgaacgtccagtggtacctcgaaaacacgctgttcgacgtcgtcggcgaggtgtat
caagaactcgaggacgcgctcgcggagcggtcggcgttcgacgccgaacaacgggtgccg
acgctgttcgagttccggtcgtgggcgggcagcgaccgggacggcaacccctacgtaacg
ccggaagtgacgaccgcgacgctgtcgagacagcggcgcgtcgttctcgagaagtaccgc
gaggaactaaaacggctctcgggcgtgttgagccaggactccgatcacgtcgagatcggc
tccgaggtcgacgagcggctggcacaccacgaggaggcgctgccgtccgtctccgccgag
gccgaagagcgatatccggacgagccgtaccgacagctcctgcggttgatgcgcgagcga
ctcgaccgcgtcgggaccgtccgccccggcgagtacggccacgtcgacgagttcgtcgcc
gacctggacgccatcggggacgatctccgctcgaacgccgctggcaacgtcgcggacgtc
cacgtcgacccgctccgcaggcaggtcgagacgttcggctttacgcttgcgagtctcgac
ctgcgggaccaccaggagaaccacaccctcgcgatcgaggcggcgctcgagagacagggg
atcgactacgccggactggacgaaaccgagcgcgtcgagttcctgacggacgccatcgcc
gaggacgacccgatcctcgagttcgacgacctcggggaactcgacgagaccaccgagcgc
gttctcacccgattcgaacggctggccgactggcaacgcgagtacggcaccgacgcgatc
gacacgtactgcatctcgatgtgcgaggagccgagccacgtcctcgaggtgctgttcttg
gccgatcaggtcgacgtcgtcgacctccccggccactcggggctcgacgtggtgccgctt
ttggagaccgagtacgccctctcgggggcccgccgaatcatcgggacgctcttcgagaac
gacgcctacgccgcggcgctcgaagcgcgcggggggacacaggaggtcatgctcggatac
tccgactcctgtaaggagaacggcttcttcgccgcccagtggtccctccagcggaacgaa
aagcgactcgcgaacatctgttcggactacggcgtcgatttgcggctgttccacggacgc
ggagggtcgatctcacgcggtggcggtccgatgaacgacgcgttgctcgcgctcccgaac
gagacggtgaccggcgaggtgaagttcaccgagcagggcgaggcgatcgccgagaagtac
gccagcccgaagatcgccgagcgcgaactcgagcagatgctcaacgcgcagctgcgggcc
agacagggagcgatcgaacggcccaccgaaccggtcgaagaggagtggatcgaagcgatg
gagaccggagcggcggccgccagggaggcctacgaggacctactggagaccgagggcttc
gtcgccttcttcgagcaggcgacgccgatcacggtcatcgagaacctcaatctcggctcg
cggcccgcgtccagaagcggcgagcggacggtcgaggatctgcgggcgatcccgtgggtc
ttcgcgtggacgcaggcgcggtgtatcgttcccgggtggtactcgctggcgaccggcctc
gacgcgtatctcgaggacggcggcgatatcgagacgctcgaggagatgtacgaggcctgg
ccgtttttccggagcatgctcgacaacgcggcgatcgcgctggcgaagacggacatgacc
atcgccgcggagtacgccgccctcgcggaggaggacctcagagagcggatcttcaccgat
atcgaggccgagtacgagcgggccgtcgggttggtatcggagatcacggggggggactcg
ctgccgctgtccgggtggttcgaggagagcctccggcgtcggaacccctacgtcgacccg
ctgaacctgttgcagttgcggttgctgtcgcgctcggagcgctcagaggccgagcggcgg
gcgctccgcatgacggtcaaggggatcgcggctggcatgaaaaacactggctag

DBGET integrated database retrieval system