KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0186Help
Entry
NMBM04240196_0186 CDS       T01948                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00061  Fatty acid biosynthesis
nmq00780  Biotin metabolism
nmq01100  Metabolic pathways
nmq01212  Fatty acid metabolism
Module
nmq_M00083  Fatty acid biosynthesis, elongation
nmq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nmq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMBM04240196_0186 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMBM04240196_0186 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nmq01004]
    NMBM04240196_0186 (fabZ)
Enzymes [BR:nmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NMBM04240196_0186 (fabZ)
Lipid biosynthesis proteins [BR:nmq01004]
 Fatty acid synthase
  Component type
   NMBM04240196_0186 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ADZ00725
LinkDB All DBs
Structure
PDB: 

Position
complement(182489..182938)
Genome map
AA seq 149 aa AA seqDB search
MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVM
PGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSR
RGIGKFNAVAKVDGQVAVEAVIMCAKRVV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacaactccccatcgaagccaaagacatccaaaaactcatcccccaccgctat
ccgtttctccagctcgaccgcatcaccgccttcgagccgatgaaaaccctgaccgcgatt
aaaaacgtcaccataaacgagccgcagttccaaggccatttccccgacctgcccgtgatg
cccggcgtactcatcatcgaagcgatggcgcaggcgtgcggcacgttggcgattttgagc
gaaggcgggcgcaaagaaaacgaattcttcttcttcgccggcatagacgaagcccgtttc
aaacgccaagtcatccccggcgaccaactcgtctttgaagtcgaactgctgaccagccga
cgcggcatcggcaaattcaacgccgttgccaaagtggacgggcaagtcgccgtcgaagcc
gtgattatgtgcgccaaacgcgtggtttga

DBGET integrated database retrieval system