KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1557Help
Entry
NMBM04240196_1557 CDS       T01948                                 

Gene name
secF
Definition
(GenBank) protein-export membrane protein SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq03060  Protein export
nmq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nmq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NMBM04240196_1557 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NMBM04240196_1557 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nmq02044]
    NMBM04240196_1557 (secF)
Secretion system [BR:nmq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NMBM04240196_1557 (secF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG PET117
Motif
Other DBs
NCBI-ProteinID: ADZ01996
LinkDB All DBs
Position
complement(1652367..1653302)
Genome map
AA seq 311 aa AA seqDB search
MELFKIKRDIPFMSYGKLTTFISLVTFIAAVFFLVTRGLNFSVEFTGGTVMEVQYQQGAD
VNKMRERLDTLKIGDVQVQALGTNKHIMIRLPNKEGVTSAQLSNQVMDLLKKDSPDVTLR
QVEFIGPQVGEELVSNGLMALGFVVIGIIIYLSMRFEWRFAVSAIIANMHDIVIILGCFA
FFQWEFSLTVLAGILAVLGYSVNESVVVFDRIRENFRKPAMRGHAVPEVIDNAITATMSR
TIITHGSTEAMVVSMLVFGGAALHGFSMALTIGIVFGIYSSVLVASPLLLMFGLSRDNIG
KEPKKKEEIVV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaactctttaaaatcaaacgcgatattccgtttatgagctacggcaaactgacgacc
ttcatttcgttggttacgtttatcgctgccgtgttctttttggttaccagaggtctgaat
ttctctgtcgaatttaccggcggtacggtaatggaagtccaatatcagcagggtgcggat
gtcaataagatgcgcgaacgcctcgatacgctgaaaataggtgatgtacaggttcaggca
ttgggtacgaacaaacacatcatgatccgcctgccgaacaaagaaggtgttacttccgca
cagttgtccaatcaggttatggatttgctgaaaaaagacagtcccgacgttaccttgcgc
caagtcgaatttatcggcccgcaagtcggtgaggaattggtaagtaatggattgatggct
ttaggttttgtcgttatcggcatcattatttacctgtcgatgcgttttgaatggcgtttt
gccgtatctgccattatcgccaatatgcacgacatcgtgattattctcggctgctttgcc
ttcttccaatgggaattttcgctgaccgtcttggcgggtatccttgccgtattgggctat
tctgtgaacgaatccgtcgtcgtcttcgaccgtatccgtgaaaacttccgcaagccggcg
atgcgcggacatgccgtgccggaagtcatcgacaacgcgattaccgcaacgatgagccgc
accatcattacccacggttcgaccgaggcgatggtcgtatccatgctggtgttcggcggt
gcggccttgcacggcttttctatggcgttgaccattggcatcgtgttcggcatttattct
tccgtattggttgccagcccgcttctgctaatgttcggtttgagccgcgacaatatcggt
aaagaaccgaagaagaaagaagaaatcgtggtttga

DBGET integrated database retrieval system