KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1562Help
Entry
NMBM04240196_1562 CDS       T01948                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00340  Histidine metabolism
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMBM04240196_1562 (hisE)
Enzymes [BR:nmq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     NMBM04240196_1562 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG GIT_SHD
Motif
Other DBs
NCBI-ProteinID: ADZ02001
LinkDB All DBs
Position
1658442..1658765
Genome map
AA seq 107 aa AA seqDB search
MGDSVLSAIQQTITQRKSANPSESYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNPSHL
VYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLSGLAEKAARTES
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccgtactatccgccatccaacaaaccatcacccagcgaaaatctgccaat
ccgtccgaatcttacgtcgcacagctcttgcacaagggcgaggacaaaatcctaaaaaaa
gtgattgaagaggcgggcgaagtgttgatggcatccaaagacaaaaacccgtcccacctg
gtttacgaagttgccgacttatggtttcacaccatgattcttctgacacaccacgacctg
aaggcggaagacgtattggacgaacttgcgcgccgccaaggtttgtcgggcttggccgaa
aaagccgctcgcacagaatcttga

DBGET integrated database retrieval system