KEGG   Nitrosopumilus maritimus: Nmar_0160Help
Entry
Nmar_0160         CDS       T00626                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00440  Phosphonate and phosphinate metabolism
nmr01100  Metabolic pathways
nmr01120  Microbial metabolism in diverse environments
nmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Nmar_0160
Enzymes [BR:nmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Nmar_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL Pantoate_transf PucR
Motif
Other DBs
NCBI-ProteinID: ABX12056
UniProt: A9A1T5
LinkDB All DBs
Position
complement(148450..149349)
Genome map
AA seq 299 aa AA seqDB search
MNDGANILNSQLNQKSILKVAGAFDAMSAKLVELSGFDAIWAGSFAISATHALPDASILT
MTEFLSVASNMTDACSIPVIADCDTGFGGPSNVSHMVKKYESAGVAAVSIEDKIFPKQNS
LLENGNQQLLSEKDFVAKLIAAKNAKVNENFMIIARVEALIAGLGVDEALKRANAYKKAG
ADAILIHSKSKTPDEIFEFCDLWDGDIPIIAIPTSYPNVTIDELEKHKIRIAIYANQSLR
VAHLAMKEHLEQLSKAKSLSQIKSNMTTMEEIFKLQEMYEIKKQETDIEKNLKKLGYIN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatggtgcaaacatactaaactctcaacttaatcaaaaatcaattttgaaagtt
gctggtgcatttgatgcaatgtcggcaaaattagtggaattgagcggttttgatgcaatt
tgggccgggagttttgcaatttctgcaactcatgcattaccagatgccagtattcttaca
atgacagaatttctttctgtagcatctaatatgactgatgcttgctcaattccagttatt
gcagattgcgatacagggtttggtggaccgagcaatgtgagtcacatggtaaaaaaatat
gaaagtgcaggagtggctgcagttagtattgaggataagatttttcctaaacaaaacagt
ttattggaaaacggtaatcaacaattgttatcagaaaaagattttgttgcaaaattaatt
gcagctaaaaatgctaaagtaaatgaaaattttatgatcattgccagagtggaggcatta
atagctggattaggggtagatgaagcattgaaaagagctaatgcatacaaaaaagctggg
gcagatgcgattttaattcattcaaagagtaaaactcctgatgagatttttgaattttgt
gatttgtgggacggagatatacccataattgcaattccaacatcatatccaaatgtaact
attgatgaattagaaaaacacaaaataagaatagcaatttatgcaaatcaatcacttcga
gtagcacatttagcaatgaaagaacatctggagcaactatctaaagctaaaagtctcagt
caaataaaatcaaatatgactacaatggaagaaatttttaaactgcaagaaatgtatgaa
ataaaaaaacaagaaacagatatagaaaaaaatcttaaaaaattgggttacataaattga

DBGET integrated database retrieval system