KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0600Help
Entry
NMBM01240355_0600 CDS       T01947                                 

Definition
(GenBank) septum formation protein Maf
  KO
K06287  septum formation protein
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nms00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    NMBM01240355_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf RAP SAT
Motif
Other DBs
NCBI-ProteinID: ADY99144
LinkDB All DBs
Position
complement(660668..661276)
Genome map
AA seq 202 aa AA seqDB search
MNTLYLGSNSPRRMEILTQLGYQVVKLPANIDETVRQNEDPARYVQRMAEEKNRTALTLF
CETNGTMPDFPLITADTCVVSDGIILGKPHSQAEAIEFLNRLSGKQHTVLTAVCIHYRGN
AENRVQTNRVVFKPLSSEEISAYVQSGEPMDKAGAYAVQGIGGIFIQSIEGSFSGIMGLP
VYETVSMLQDLGYRSPLSALKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaataccctctatttaggttcaaacagcccgcgccgaatggaaatcctgacacagttg
ggctatcaggtcgtcaagctgcctgccaacatcgacgaaacggtcagacagaacgaagac
cctgcccgttacgttcaaaggatggcagaagaaaaaaaccgaaccgccctgaccctcttt
tgcgaaaccaacggcacaatgcccgatttccccctgattaccgccgacacctgcgtcgtt
tcagacggcatcatattaggcaaaccccactcccaagccgaagcaatcgaatttttaaac
cgattgtccggcaaacaacataccgtcctgactgccgtctgcattcattatcgcggcaat
gcggaaaaccgcgtccaaaccaaccgcgttgtttttaagcccctgagttcggaagaaatt
tccgcctatgtgcaaagcggcgaaccgatggacaaagccggtgcctacgccgtacaaggc
ataggcggcatctttatccaatctatcgaaggcagcttcagcggcattatgggactgccc
gtttatgaaaccgtttcgatgttgcaggatttgggataccgctcccccttgtccgccctt
aaaccgtaa

DBGET integrated database retrieval system