KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0948Help
Entry
NMBM01240355_0948 CDS       T01947                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00020  Citrate cycle (TCA cycle)
nms00190  Oxidative phosphorylation
nms00650  Butanoate metabolism
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01120  Microbial metabolism in diverse environments
nms01130  Biosynthesis of antibiotics
nms01200  Carbon metabolism
Module
nms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nms_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240355_0948 (sdhA)
   00650 Butanoate metabolism
    NMBM01240355_0948 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMBM01240355_0948 (sdhA)
Enzymes [BR:nms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMBM01240355_0948 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NMBM01240355_0948 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADY99475
LinkDB All DBs
Position
1001416..1003179
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREVMAIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattatccaaatccggtctgaattgtgccgttttgtctaaagtgttc
ccgacccgttcgcataccgtagcggcgcagggcggtatttccgcctctctgggtaatgtg
caggaagaccgttgggactggcacatgtacgataccgtgaaaggttccgactggttgggc
gaccaagatgcgattgagtttatgtgccgcgccgcgcctgaagccgtaattgagttggaa
cacatgggtatgccttttgaccgtgtggaaagcggtaaaatttatcagcgtcctttcggc
ggccatactgccgaacacggtaaacgcgcggtagaacgcgcctgtgcggttgccgaccgt
acaggtcatgcgatgctgcatactttgtaccaacaaaacgtccgtgccaatacgcaattc
tttgtggaatggacggcacaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaaccggcgaagtttatattttccacgctaaagctgtgatgttt
gctaccggcggtggcggtcgtatttatgcttcttctaccaatgcctatatgaataccggc
gatggtttgggcatttgcgcgcgtgcgggtattccgttggaagatatggaattctggcaa
ttccacccgaccggcgtggcaggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaatgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgttgtttcccgcgcgatggcgatggaaatctacgaaggt
cgcggctgcggtaaaaacaaagaccatgtcttactgaaaatcgaccatatcggcgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagttcgctggtatcgat
ccgattaaagacccgattcccgttgtgccgactacccactatatgatgggcggtattccg
accaactaccatggcgaagttgtcgttcctcaaggcgacgaatacgaagtgcctgtaaaa
ggtctgtatgcggcaggtgagtgcgcctgtgcttccgtacacggtgcgaaccgcttgggt
acgaactccctgctggacttagtggtattcggtaaagctgccggcgacagcatgattaaa
ttcatcaaagagcaaagcgactggaaacctttgcctgctaatgccggcgaactgacccgc
caacgtatcgagcgtttggacaatcaaactgatggtgaaaacgttgatgcattgcgccgc
gaactgcaacgctccgtacaattgcacgccggcgtgttccgtactgatgagattctgagc
aaaggcgttcgagaagtcatggcgattgccgagcgtgtgaaacgtaccgaaatcaaagac
aagagcaaagtgtggaataccgcgcgtattgaggctttggaattggataacctgattgaa
gtggcgaaagcgactttggtgtctgccgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgagatgatgaaaactggatgaaacatacgctgtaccattca
gataccaataccttgtcctacaaaccggtgcacaccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system