KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0949Help
Entry
NMBM01240355_0949 CDS       T01947                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00020  Citrate cycle (TCA cycle)
nms00190  Oxidative phosphorylation
nms00650  Butanoate metabolism
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01120  Microbial metabolism in diverse environments
nms01130  Biosynthesis of antibiotics
nms01200  Carbon metabolism
Module
nms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nms_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240355_0949
   00650 Butanoate metabolism
    NMBM01240355_0949
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMBM01240355_0949
Enzymes [BR:nms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMBM01240355_0949
    1.3.5.4  fumarate reductase (quinol)
     NMBM01240355_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_9 Fer4_7 Fer4_20
Motif
Other DBs
NCBI-ProteinID: ADY99476
LinkDB All DBs
Position
1003308..1004006
Genome map
AA seq 232 aa AA seqDB search
MSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLKAQDDTLSFRRSCREGICGSD
GMNINGKNGLACLTDLRGLKQPVKIRPLPGLPVIRDLIVDMTQFFKQYHSVKPYVVNDNP
IDADKERLQTQEERKELDGLYECILCACCSTACPSFWWNPDKFVGPSGLLNAYRFIADSR
DTITNERLDNLNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKRAV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaatttaccgttacaacccggatgttgatgccaagccttatatgcagcgt
tacgagttggaattggaaccgaccgacgtgaaacttttggatgctttggtacgcctgaaa
gcacaagacgataccttgtctttccgccgctcctgccgcgaaggcatttgcggatcggac
ggtatgaacatcaacggcaaaaacggcttggcgtgtttgaccgatctgcgtggcttgaaa
cagccagttaaaatccgtcctctgccaggtctgcctgttatccgcgacctgattgtggat
atgacccagttcttcaaacaataccattccgtcaaaccttatgttgtcaacgataatccg
attgatgcggacaaagagcgtctgcaaactcaggaagagcgtaaagagttggacggtttg
tacgagtgtattttgtgcgcctgctgttcgactgcctgcccgtcattttggtggaaccct
gataaattcgttggtccgtccggtttgctgaatgcttaccgtttcattgcggacagccgt
gataccatcactaatgagcgtttggataatctgaacgacccataccgtttgttccgttgc
cacaccattatgaactgtgtggacgtatgtcctaaacacttgaatccgacccgagccatc
ggtaagattaaagagattatgttgaaacgggccgtttaa

DBGET integrated database retrieval system