KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1070Help
Entry
NMV_1070          CDS       T01928                                 

Gene name
uvrC
Definition
(GenBank) UvrABC system protein C (UvrC protein; excinuclease ABC subunit C)
  KO
K03703  excinuclease ABC subunit C
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    NMV_1070 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nmt03400]
    NMV_1070 (uvrC)
DNA repair and recombination proteins [BR:nmt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NMV_1070 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH HHH_2 HHH_5 HHH_3
Motif
Other DBs
NCBI-ProteinID: CAX49936
LinkDB All DBs
Position
complement(1078087..1079940)
Genome map
AA seq 617 aa AA seqDB search
MNTENRSPEQFDIPLFLKNLPKLPGVYRFFDEGGKVLYVGKAVNLKRRVSGYFQKNDHSP
RIALMVKQVRHIETTITRSEAEALILENNFIKALSPKYNILFRDDKSYPYLMLSGHQYPQ
MAYYRGTLKKPNQYFGPYPNSNAVRDSIQILQKVFMLRTCEDSVFEHRDRPCLLYQIKRC
TAPCVGHISEEDYRDSVRQAATFLNGKTDELTRTLQHKMQTAAANLQFEEAARYRDQIQA
LGIMQSNQFIDSKNPNNPNDIDLLALAVSDGIVCVHWVSIRGGRHVGDKSFFPDTKNDPE
PNGQDYAEAFVAQHYLGKSKPDIIINNFPVPDALKEALEGEHGKQMQFVTKTIGERKVWL
KMAEQNAQMAIAQRRLQQSSQQHRIDELAKILGMDSDGLNRLECFDISHTQGEATIASCV
VYDEQNIQPSQYRRYNITTAKPGDDYAAMREVLTRRYGKMQEAEANGETVKWPDAVLIDG
GKGQIGVAVSVWEELGLHIPLVGIAKGPERKAGMEELILPFTGEVFRLPPHSPALHLLQT
VRDESHRFAITGHRKKRDKARVTSSLGDIPGVGSKRRQALLTRFGGLRGVIAASREDLEK
VEGISKALAETIYNHLH
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaaaaccgttctccggaacaattcgacatcccgctcttcctcaaaaacctg
cccaagctgccgggcgtgtaccgtttttttgacgaaggcggcaaagtcttatacgtcggc
aaagccgtcaacctcaagcggcgcgtgtccggctatttccaaaaaaacgaccattcgccg
cgcatcgcgttgatggtgaaacaggttcgccacatcgaaaccaccatcacgcgttccgaa
gccgaagccctgattctcgaaaacaacttcatcaaagccttgtcgccgaaatacaatatc
cttttccgcgatgacaaaagctatccttatctgatgctcagcggccatcaatatccgcaa
atggcgtattaccgcggcacgctgaaaaagcccaaccaatacttcggcccgtatcccaac
agcaacgctgtgcgcgacagcatccaaatcctgcaaaaagtcttcatgctgcgcacctgc
gaagacagcgtgttcgaacaccgcgaccgcccttgcctgctgtaccaaatcaaacgctgt
accgcgccctgcgtcggacacatcagcgaagaagactaccgcgacagcgtgcgtcaagcc
gccacttttctcaacggcaaaaccgacgaactgacccgcaccctgcaacacaaaatgcaa
actgccgccgcgaatctgcaatttgaagaagccgcacgttaccgcgatcaaattcaagca
cttggcatcatgcagagcaaccagttcatcgacagcaaaaacccgaacaaccccaacgat
atcgacctgctcgcgctggcggtttcagacggcatcgtctgcgtacactgggtcagcata
cgcggcggacggcacgtcggcgacaaaagctttttccccgacaccaaaaacgatcccgag
ccaaacgggcaagactatgccgaagccttcgtcgcccaacactatctgggcaaaagcaaa
cccgacattatcatcaacaacttccccgtccccgatgcgctgaaagaggctttggaaggc
gaacacggcaaacaaatgcaatttgtcaccaagaccataggcgaacgcaaagtttggttg
aaaatggcggagcaaaacgcacaaatggcgattgcacaacgccgcctgcaacaaagcagc
cagcaacaccgcatcgacgaactcgccaaaatcctcggtatggattcagacggcctcaac
cgcctcgaatgtttcgatatcagccacacccaaggcgaagccactattgcgtcctgcgtt
gtgtacgatgagcaaaacatccagccttcgcaataccgccgctacaacatcacgaccgcc
aagcccggcgacgactacgccgccatgcgcgaagtgttgacgcgccgttacggcaaaatg
caggaagccgaagccaacggcgagaccgtcaaatggccggatgccgtgttaattgacggc
ggcaaagggcaaatcggcgtagccgtatcggtatgggaagaactcgggctgcacattcct
ttggtcggtatcgccaaaggcccggagcgcaaagccggtatggaagaactcatactgcct
tttaccggcgaagtcttccgcctgcccccacacagcccggccttgcatctattgcaaacc
gtacgcgatgaatcgcaccgctttgccatcacaggccaccgcaaaaaacgcgacaaagcg
cgcgttacctcatccctcggcgacattcccggcgtaggcagcaaacgccgccaagccctg
ctcacccgcttcggcggtctgcgcggcgtgattgccgccagccgcgaggacttggaaaaa
gtggaaggcatcagcaaggcattggcggaaacgatttacaatcatctgcattaa

DBGET integrated database retrieval system