KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1444Help
Entry
NMV_1444          CDS       T01928                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00020  Citrate cycle (TCA cycle)
nmt00190  Oxidative phosphorylation
nmt00650  Butanoate metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
Module
nmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMV_1444 (sdhA)
   00650 Butanoate metabolism
    NMV_1444 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMV_1444 (sdhA)
Enzymes [BR:nmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMV_1444 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NMV_1444 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CAX50275
LinkDB All DBs
Position
complement(1410339..1412102)
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPADAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREVMAIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattatccaaatccggtctgaattgtgccgttttgtctaaagtgttc
ccgacccgttcgcataccgtagcggcgcagggcggtatttccgcctctctgggtaatgtg
caggaagaccgttgggactggcacatgtacgataccgtgaaaggttccgactggttgggc
gaccaagatgcgattgagtttatgtgccgcgccgcgcctgaagccgtaattgagttggaa
cacatgggtatgccttttgaccgtgtggaaagcggtaaaatttatcagcgtcctttcggc
ggccatactgccgaacacggtaaacgcgcggtagaacgcgcctgtgcggttgccgaccgt
acaggtcatgcgatgctgcatactttgtaccaacaaaacgtccgtgccaatacgcaattc
tttgtggaatggacggcacaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaaccggcgaagtttatattttccacgctaaagctgtgatgttt
gctaccggcggtggcggtcgtatttatgcttcttctaccaatgcctatatgaataccggc
gatggtttgggcatttgcgcgcgtgcgggtattccgttggaagatatggaattctggcaa
ttccacccgaccggcgtggcaggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaatgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgttgtttcccgcgcgatggcgatggaaatctacgaaggt
cgcggctgcggtaaaaacaaagaccatgtcttactgaaaatcgaccatatcggcgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagttcgccggtatcgat
ccgattaaagacccgattcccgttgtgccgactacccactatatgatgggcggtattccg
accaactaccatggcgaagttgtcgttcctcaaggcgacgaatacgaagtgcctgtaaaa
ggtctgtatgcggcaggtgagtgcgcttgtgcttccgtacacggtgcgaaccgcttgggt
accaactccctgttggacttggtggtattcggtaaagctgccggcgacagcatgattaaa
ttcatcaaagagcaaagcgactggaaacctttgcctgcggatgcgggcgagctgacccgc
caacgtatcgagcgtttggacaatcaaactgatggcgaaaacgtcgatgcgctgcgtcgc
gaactgcaacgctccgtacaactgcacgccggcgtgttccgtactgatgagattctgagc
aaaggcgttcgagaagtcatggcgattgccgagcgtgtgaaacgtaccgaaatcaaagac
aagagcaaagtgtggaataccgcgcgtatcgaggctttggaattggataacctaattgaa
gtggcgaaagcgactttggtgtctgccgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgcgatgatgaaaactggatgaaacatacgctgtaccattca
gataccaatactttgtcttacaaaccggtacataccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system