KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1809Help
Entry
NMV_1809          CDS       T01928                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase (PRA-PH)
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00340  Histidine metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMV_1809 (hisE)
Enzymes [BR:nmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     NMV_1809 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG GIT_SHD
Motif
Other DBs
NCBI-ProteinID: CAX50618
LinkDB All DBs
Position
1742906..1743229
Genome map
AA seq 107 aa AA seqDB search
MGDSVLSAIQQTITQRKSANPSESYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNPSHL
VYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLSGLAEKAARTES
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccgtactatccgccatccaacaaaccatcacccagcgaaaatctgccaat
ccgtccgaatcttacgtcgcacagctcttgcataagggcgaagacaaaatcctaaaaaaa
gtgattgaagaggcgggcgaagtgttgatggcatccaaagacaaaaacccgtcccacctg
gtttacgaagttgccgacttatggtttcacaccatgattcttctgacacaccacgacctg
aaggcggaagacgtattggacgaacttgcgcgccgccaaggtttgtcgggcttggccgaa
aaagccgctcgcacagaatcttga

DBGET integrated database retrieval system