KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1814Help
Entry
NMV_1814          CDS       T01928                                 

Definition
(GenBank) putative Maf-like protein
  KO
K06287  septum formation protein
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    NMV_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf RAP SAT
Motif
Other DBs
NCBI-ProteinID: CAX50623
LinkDB All DBs
Position
1745401..1746009
Genome map
AA seq 202 aa AA seqDB search
MNTLYLGSNSPRRMEILTQLGYQVVKLPADINETVRQNEDPARYVQRMAEEKNRTALTLF
CETNGTMPDFPLITADTCVVSDGIILGKPRSQAEAIEFLNRLSGKQHTVLTAVCIHYRGK
TSSRVQTNRVVFKPLSSEEISAYVQSGEPMDKAGAYAVQGIGGIFIQSIEGSFSGIMGLP
VYETVSMLQDLGYRSPLSALKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaataccctctatttaggttcaaacagcccgcgccgaatggaaatcctgacacagttg
ggctatcaggtcgtcaagctgcctgccgacatcaatgaaacggtcagacagaacgaagac
cctgcccgttacgttcaaaggatggcagaagaaaaaaaccgaaccgccctgaccctcttt
tgcgaaaccaacggcacaatgcccgatttccccctgattaccgccgacacctgcgtcgtt
tcagacggcatcatattgggcaaaccccgctcccaagccgaagcaatcgaatttttaaac
cgattgtccggcaaacaacataccgtcctgactgctgtctgcattcattatcgcggcaaa
acgtcaagccgcgtccaaaccaaccgcgtcgttttcaagcccctgagttcggaagaaatt
tccgcctatgtgcaaagcggcgaaccgatggacaaagccggcgcctacgccgtacaaggc
ataggcggcatctttatccaatctatcgaaggcagcttcagcggcattatgggactgccc
gtttatgaaaccgtttcgatgttgcaggatttgggataccgctcccccttgtccgccctt
aaaccgtaa

DBGET integrated database retrieval system