KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_2051Help
Entry
NMV_2051          CDS       T01928                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase (A subunit of acetyl-CoA carboxylase; ACC)
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00061  Fatty acid biosynthesis
nmt00620  Pyruvate metabolism
nmt00640  Propanoate metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
nmt01212  Fatty acid metabolism
Module
nmt_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMV_2051 (accC)
   00640 Propanoate metabolism
    NMV_2051 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMV_2051 (accC)
Enzymes [BR:nmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NMV_2051 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NMV_2051 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GARS_A RimK Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: CAX50820
LinkDB All DBs
Position
1969689..1971050
Genome map
AA seq 453 aa AA seqDB search
MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKDSLHVKLADESVCIGPAASAQSY
LNVPAIIAAAEVSCADAVHPGYGFLAENADFAEQVEQSGFTFIGPKPDTIRLMGDKVSAK
HAMIAAGVPCVPGSDGALPDDGEEILKIADKVGYPVIIKASGGGGGRGMRVVEKKEDLLQ
SVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVIADEHGNAIYLAERDCSLQRRHQKVI
EEAPAPFITEKERAKIGNACADACKRIGYRGAGTFEFLYEDGEFFFIEMNTRVQVEHPVT
ELITGVDIVQEQLRIAAGLPLQYKQKDIQVEGHAFECRINAEDPYNFIPSPGPIESCHLP
GGFGIRVDSHIYQGYRIPPYYDSLIGKICVVGKDRDQAMAKMRVALAELAITGIKTNTPL
HRDLFNDPGFQKGGVSIHYLEHWLEDRKAKQDK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaagttttaatcgccaaccgaggcgaaatcgcattacgcgtactccgtgcc
tgccgcgaaatgggcattgccaccgtcgccgtgcattccgaggccgacaaagacagcctg
cacgtcaaactcgccgacgaatccgtgtgcatcggccctgccgcttccgcgcaaagctac
cttaacgtccccgccattatcgccgccgccgaagtaagctgcgcggacgctgtccacccg
ggctacggtttccttgccgaaaacgccgatttcgccgaacaggtcgagcagtccggcttt
acctttatcggcccgaaacccgacaccatccgcctgatgggcgacaaagtctccgccaaa
cacgcgatgatagcggcaggcgtaccctgcgtccccggttctgacggcgcattgcccgac
gacggcgaagaaatcctcaaaatcgccgataaagtcggttatcccgtcattatcaaagcc
tctggcggcggcggcggccgcggtatgcgcgtggtcgagaaaaaagaagacctcctccaa
tctgtcgaaatgaccaaagccgaagcaggcgcggcattcggcaacccgatggtttacatg
gaacgctatctgcaacgtccgcgccacgtcgaaatccaagtgattgccgacgaacacggc
aacgccatctaccttgccgagcgcgactgttcgctgcaacgccgccaccaaaaagtcatc
gaggaagcaccggctccgttcatcactgaaaaagaacgcgccaaaatcggcaacgcctgt
gccgatgcctgcaaacgcatcggctaccggggcgcgggtacgtttgagtttttatacgaa
gacggcgaatttttctttatcgagatgaacacgcgcgttcaggtcgagcatccggttacc
gagctcatcaccggcgtggacatcgtgcaggagcaactccgcatcgccgccggcctgcct
ttgcaatacaaacaaaaggatattcaagtcgaaggccacgcgtttgagtgccgtatcaac
gccgaagacccgtacaacttcatccccagcccgggcccgattgaaagctgccacctgccc
ggcggcttcggtatccgcgtggacagccacatttaccaaggctaccgcatcccaccgtac
tacgacagcctgatcggcaaaatctgcgtcgtcggtaaagaccgcgaccaagccatggct
aaaatgcgcgtagcccttgccgaactggcgattaccggcatcaaaaccaatacgccgctg
caccgcgacttgttcaacgacccaggtttccaaaaaggcggcgtcagcatccactatttg
gaacactggctggaagatcgcaaagccaaacaggacaaataa

DBGET integrated database retrieval system