KEGG   Nitrosospira multiformis: Nmul_A0231Help
Entry
Nmul_A0231        CDS       T00302                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nmu  Nitrosospira multiformis
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nmu01004]
    Nmul_A0231
Enzymes [BR:nmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Nmul_A0231
Lipid biosynthesis proteins [BR:nmu01004]
 Acyl-CoA synthetase
  Unknown
   Nmul_A0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABB73539
UniProt: Q2YCI2
LinkDB All DBs
Position
complement(244769..246595)
Genome map
AA seq 608 aa AA seqDB search
MSSTIAKLNAPLTQAFNPQLSSEQPAAAIPTPTYNTQAQRLADFDTLIAALEYAAAGTAG
YNFYDAKGNLRSVLPYQALRQNAQTAARQLLRLGLARGDRVAIIADTTPEFVEIFYACRY
AGLVPYAMPVPVNLGSHAVYVRQLRGMLEAGQASAALANADYVDFLKEAAEGSQYLRWVG
TPEQLGELPASITELAPNSPDEIAYLQFTSGSTRMPRGVVITEGALMSNLQGIVRHGLNI
RAGDRCASWLPFYHDMGLVGMVMAPMVAQVSVDYLATRDFAIRPLQWLRLISRNRATVAF
SQPFGLKLCTLRVRDSDLEDLDLSSWRAAGVGAEMIRPDTLRNFAEKFAPAGFDARAFLP
CYGLAESTLAVTFSEVGQGFQSLRVDAATLVDRKMAVRLQVEGRKYSEFVNCGRALPGHI
VKVIDEAGQQLPDLRVGSVLVQGSSIMTGYFNNPEDTGKTLKPGNWLDTGDLGFLFEGDL
YITGRRTDVIIVNGRNIRAQDIEELAEQQPEVRTREASAFGITDANDVTTIVLVIECRLT
SITDRQSLTSRLQRLVYMAFGVNCLVELVPPHTLPRTSSGKLSRFAARQGFIQRTQMTDQ
LSAESGDK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcaacaatagcaaagttgaacgctccgctgacgcaagcgtttaaccctcaatta
tcaagcgagcagccggcagctgcgatccccacacccacctacaacactcaagctcagaga
ttagccgacttcgacaccttgatcgctgcgctcgagtatgcggcggcaggtacagccgga
tataacttttacgatgccaagggtaatctccgctctgttcttccctatcaggcattaagg
caaaatgcccaaacagcggcgcggcagttgctgcggcttgggttggcgagaggagaccgt
gttgcgattattgccgacacgacgccggagttcgtggagatcttttatgcatgccgctat
gcagggctggtaccttatgcaatgcctgttcctgtcaacctcggcagccatgcggtttat
gttcggcagttgcgcggaatgctggaagcgggccaggcaagcgccgctctggcgaacgcc
gactatgtcgatttcttgaaagaagcggccgaggggtcccaatatctgcgttgggtggga
acgccggagcaactcggggaactgccggcgtcgatcaccgagcttgcgccaaatagtccg
gatgaaatcgcatatctgcaatttacttcgggaagcacgcgcatgccccgtggagtagta
attaccgaaggtgcactaatgagcaaccttcagggcattgtccgtcacggtctgaatatc
cgggcaggagaccgctgcgcatcctggttgccgttttatcatgacatgggcttggttggc
atggtaatggcccccatggtggcgcaagtttccgttgattatctggctacccgtgatttt
gcaatcaggccgctgcaatggctgcggctgatcagcagaaatcgcgctaccgtcgcattc
agccaaccttttggactcaagctctgcacgcttcgcgtgcgcgattccgacttggaagat
cttgacctcagcagttggcgtgcagcgggagtcggcgcggaaatgatccgtccggacact
ttgaggaattttgcggaaaaatttgcgcctgccggttttgacgcgcgcgcattcctcccc
tgctacgggctggctgaatcgacgctcgccgttaccttctccgaagttggccaaggtttt
cagagtttgcgcgtcgacgcggcaaccctcgttgacaggaaaatggcggtacggttacag
gtggaaggccggaagtatagtgaatttgtcaattgcggccgcgccttgccgggacatatc
gtcaaagtgatcgacgaggccggccagcaactcccggatttgcgagtaggcagcgtactc
gtgcagggcagcagtatcatgacaggttatttcaacaatccggaagataccggcaaaaca
ctcaaacccggaaactggctggataccggtgatctggggttcctcttcgaaggggatctt
tacatcaccgggcgccgcaccgatgtaatcatcgtcaatgggcgtaacatccgcgcgcag
gatatcgaggagcttgccgaacagcaacctgaagtgagaacgcgcgaagcgtccgccttc
ggcattactgacgccaatgacgtcacgaccattgtcctggtcatcgaatgccgacttacc
tcgataacggatcgccagtcccttaccagccgtctgcaacgtctggtctacatggcgttt
ggcgtgaattgtctggtggaactggttccaccgcacaccctgccgcgtacttcctctgga
aaactgtcccgttttgcggcccgccagggctttatccagcgaacgcagatgacagaccag
ttgtctgccgaatccggggacaaataa

DBGET integrated database retrieval system