KEGG   Nitrosospira multiformis: Nmul_A0501Help
Entry
Nmul_A0501        CDS       T00302                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nmu  Nitrosospira multiformis
Brite
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Nmul_A0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABB73809
UniProt: Q2YBR2
LinkDB All DBs
Position
560303..560920
Genome map
AA seq 205 aa AA seqDB search
MSNQNTGSAPYVLPPLPYADNALDPVISANTLGFHYGKHHKTYVDNLNKLVAGTDLADMS
LEEIITSTAGKADKAGIFNNAAQVWNHTFYWNSLSPKGGGEPPASLKQKIETAFGSVEVC
KKELATAATTQFGSGWAWLVNDGDRLQVIKTGNADLPLTKGMKPLLTIDVWEHAYYLDYQ
NRRPDYVNAVLDKLINWGFAADNDK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaataccggtagcgccccgtatgttctgccccctttaccttatgcggat
aacgcgctggaccccgtcatttcggcaaatacgcttggcttccactacggaaaacatcac
aagacctatgtcgataatctcaacaagctggttgcaggtacagatctggcggatatgtct
ctggaggagatcatcacttccactgcgggaaaggcagacaaggcaggaattttcaataac
gctgcccaggtgtggaaccataccttttactggaacagtttatcgcccaagggcgggggt
gagccgcccgcgtcgctgaagcaaaaaatcgagaccgctttcggcagcgtggaggtttgc
aaaaaggaactggcgacggcagccacaacccagttcggcagcggatgggcatggctcgta
aacgatggcgacaggctgcaggtgataaagacgggtaacgcagatctcccgctcacaaaa
ggaatgaagccgctcttaacgatcgatgtctgggaacacgcctactaccttgattaccag
aaccggcgcccggattatgtcaatgccgtgctcgacaagctgatcaactggggctttgcc
gctgacaacgataaataa

DBGET integrated database retrieval system