KEGG   Nitrosospira multiformis: Nmul_A0685Help
Entry
Nmul_A0685        CDS       T00302                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00630  Glyoxylate and dicarboxylate metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmul_A0685
Enzymes [BR:nmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nmul_A0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABB73992
UniProt: Q2YB79
LinkDB All DBs
Position
complement(786731..787165)
Genome map
AA seq 144 aa AA seqDB search
MMTNFQNRLTQGQFSFLPPLTDKQISAQIKYALKNNWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILQEINDCRKTYPNHYIRVTAFDSSRGVESPAMSYIVNRPKNEPGFGLVRQ
EVDGRQIRYTVHSYATEKPEAERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaattttcaaaaccgtctcacgcaagggcaattttcttttctgcccccgctg
acggataagcagatttcggcgcaaatcaaatatgcgctgaagaacaactgggctatcgga
attgaatataccgatgatccgcatccccgcaacacgtattgggaaatgttcggcaacccg
atgttcgacctgaaggaccccgcgggtatcctgcaggagatcaacgattgccgcaagacc
tatccgaaccactacattcgtgttacggctttcgattcatcgcgcggtgtggaaagcccg
gcgatgtcctacatcgtcaaccgtccgaagaacgagcctggttttggcttggtgcgtcag
gaagtggatggacggcaaattcgctataccgtccattcctacgcaacggaaaaaccggaa
gcagagcggtactga

DBGET integrated database retrieval system