KEGG   Nitrosospira multiformis: Nmul_A0864Help
Entry
Nmul_A0864        CDS       T00302                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00020  Citrate cycle (TCA cycle)
nmu00270  Cysteine and methionine metabolism
nmu00620  Pyruvate metabolism
nmu00630  Glyoxylate and dicarboxylate metabolism
nmu00680  Methane metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmul_A0864
   00620 Pyruvate metabolism
    Nmul_A0864
   00630 Glyoxylate and dicarboxylate metabolism
    Nmul_A0864
  09102 Energy metabolism
   00680 Methane metabolism
    Nmul_A0864
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Nmul_A0864
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Nmul_A0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ABB74167
UniProt: Q2YAQ4
LinkDB All DBs
Position
982671..983654
Genome map
AA seq 327 aa AA seqDB search
MKTPIRVAVTGAAGQIAYSLLFRIAAGDMLGEDQPVILQLLDIPQSLPSLKGVVMELDDC
AFPLLRDITITDDPKTAFRDINIAMLVGARPRTKGMERKDLLEANGTIFRAQGKALDEVA
GRDVKVLVVGNPANTNAYITMKNAPSLKPTSFSSMMRLDHNRAVFQLAVKVGQPVSSVRK
MIVWGNHSSAQYPDLSHAEVDGHNAADLVNDMAWIETGFIPVIQKRGMEVIEARGSSSAA
SAANAAICHMRDWVSGTPEGDWVSMGIPSDGSYGIPEGVIYGYPVTCQGGEYKIVPDLEI
SEFSRMKMQASYRELMGERESIKHLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcccatccgtgtcgccgtaaccggcgccgccggccagatagcttacagtctc
ttgtttcgtatcgcagcgggcgacatgcttggcgaggatcagcctgtcattctgcaattg
ctggatattcctcaatcgttgccttccttgaaaggcgttgtcatggaactggacgactgt
gcctttccattactgagggacatcaccattaccgacgaccccaaaacggcttttcgcgac
ataaatatcgccatgctggttggtgcccgtccgcgcaccaagggtatggaacgcaaggat
ctgctggaagcaaacggtacgatattccgtgcgcaggggaaggcgctcgacgaggttgcc
gggcgcgatgtgaaagtcctggtggtggggaatcccgccaataccaatgcctatatcacg
atgaaaaatgcgccgagtctgaagccgaccagcttctcgtcgatgatgcgactggaccat
aaccgcgcagtgttccagcttgccgtcaaggtcggccagccggtttccagtgtgagaaag
atgatcgtatgggggaatcactcctcagcccaatatcccgatttgagccatgccgaggtg
gacggccataatgccgctgacctcgtcaatgacatggcatggatagaaaccggtttcatt
cccgtaatacagaagcgcggcatggaggtgatcgaggcgcgtggttcttcgagtgcggcc
agcgcggccaacgccgcaatctgccacatgcgcgactgggtttcgggcactcccgaaggt
gactgggtgtccatgggtattccttcggatggaagctacggcatcccggaaggagttatc
tatggttaccccgtgacctgtcagggcggtgaatacaagatcgtgcccgacctggaaata
agcgagttcagcaggatgaagatgcaggcgagctaccgggaattaatgggagagcgcgag
tcgataaagcatctgcttggataa

DBGET integrated database retrieval system