KEGG   Nitrosospira multiformis: Nmul_A1177Help
Entry
Nmul_A1177        CDS       T00302                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Nmul_A1177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nmu03400]
    Nmul_A1177
Enzymes [BR:nmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Nmul_A1177
DNA repair and recombination proteins [BR:nmu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Nmul_A1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABB74480
UniProt: Q2Y9U1
LinkDB All DBs
Position
1355243..1357804
Genome map
AA seq 853 aa AA seqDB search
MTNDDSLKTYRAKRDFSVTPEPSGVASGKTAIKSTAKVLSFVVQKHWATRLHYDFRLELE
GTMKSWAVPKGPSFDPNDKRMAVHVEDHPISYNSFEGEIPSGQYGAGKVIIWDKGTWIPL
EDPHKGYRDGKLKFELRGLKLKGHWALVRMRKEENKKQEPWLLIKEKDEYVRSSREYSVV
DEMPDSVAELDVPDVPQPSKASATSGSSSPKSSSIFRKGTKTTLPDNARKAELPRTLTPE
LATLVDEPPVDPEEWIYEIKFDGYRMLSRIEGGEVRLITRNGNDWSHKLPHLIKALGKLK
LKSSWLDGEIAVLDENGIPDFQSLQNAFDSAHTESIIYYLFDVPFYEGYDLRDASLVERR
ALLQKLFEAHAPDEIRFSDVFDVSPAEILDSACRLGLEGVIGKRKTSVYVSRRSQDWIKL
KCKNRQEFVIGGYTDPKGTRKGIGSLLLGYYDEDRKLRYAGNVGAGFSDKTLEDLRARLD
RIALTDSPFVKANGLDKNAHWVEPRLIAEVSFGEWTRGGHIRHSVFHGLRSDKKADVIVR
EKPVHPAAKSAPASAIPKSLKVTNPDRVIDPSTGFTKVDLIRYYALVAPLMLPHLARRPV
SLVRAPEGVSGELFFQKHWEKENMPGIEQLDPSLDPDHPPLLEVSTAEGLLSAVQMNVIE
FHTWNATKNVIGKPDRIAFDLDPGSGVEWALIQESAQLVNVFLRELGLKSFLKTSGGKGL
HIVVPIRRLRDWDTVKGFSQAIVQHLAKTIPTRFTAKSGPRNRVGKIFIDYLRNGFGATT
VSAWSVRARPGLGVSVPLAWEELSSLKSSTRWSASNIHERLDKGNDPWADYAETNQSIVP
AMKKLGFTPSSKA
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgatgactcgcttaaaacttaccgggccaaacgtgatttctcggtaacacct
gagccaagcggcgttgccagtggcaagacagccatcaagagtactgccaaggttttgtcg
tttgttgtccagaagcactgggcaacgcgtctgcactacgacttcaggctggaactggaa
ggaacgatgaagagctgggctgttcccaaaggccccagtttcgaccctaacgacaaacgc
atggcggtccacgtcgaagaccatcccatttcctataacagttttgaaggcgagataccc
tcaggtcagtatggcgccggtaaagtcattatttgggataagggaacctggattcctctc
gaagatccgcacaaggggtatcgtgacggcaagctgaaattcgagctgcgggggctcaag
ctgaaagggcactgggccttggtgcgcatgagaaaggaagaaaacaaaaagcaggaaccc
tggctgctgataaaagaaaaggatgaatatgtccgttcatcgcgggagtatagcgtggtg
gacgaaatgccggacagtgtggccgaacttgacgtgccagacgtgccacaaccttccaaa
gcttccgcaacatcgggaagcagctcacccaaaagcagttcgatattccgcaagggaacg
aaaacgaccttgccggacaatgcgcgcaaggctgagcttccgcggacattgacgccggag
ctcgccacgctggtggacgagcctcctgtggatccggaagagtggatttacgaaatcaag
tttgacgggtaccggatgttgagcagaatagagggaggagaagtccgcctcataacccga
aacggaaatgactggtctcataagctgccgcatctgataaaagcgttgggaaagctcaaa
ctgaagtcgtcctggctcgatggcgaaattgcggtgctggatgaaaacggtattcccgat
ttccagtcgttgcagaatgccttcgacagcgcgcataccgagagcatcatttattatctc
ttcgatgtgcccttttacgagggatatgatttgcgggacgcttcccttgtcgaacgccgc
gccttactgcaaaaactgtttgaggcacacgcccctgatgaaatacgcttcagcgacgtt
ttcgatgtttctccagcggaaattctcgattccgcttgccggcttggactggaaggagtg
atcggcaaacgtaaaacctcggtttatgtctcgcgccgatcccaggactggataaagctc
aaatgtaaaaaccgccaggaattcgttatcggcggatatacagatcccaaaggtacgcgg
aagggtattggttctcttctgctcggttattatgatgaagaccgaaaactcagatatgca
gggaatgtaggcgcgggattcagcgataagacgctggaggacctcagggcaaggttggac
agaattgctttgacggatagcccttttgtgaaagcaaatggcctcgataaaaacgcgcat
tgggtcgaaccccggcttatcgcggaagtttccttcggtgaatggacgcgaggaggtcac
attcgtcactcggtattccacggtttgagatccgacaaaaaagcggatgtcattgttcgc
gagaagcccgtgcatcccgcggcgaagtcggcgcctgcaagcgccattccaaaatccctg
aaagtgacgaacccggaccgagtgatcgatccctccaccgggtttacaaaggtcgatctc
atacgctactacgcgctggtagcgcctttgatgctgcctcacctcgcacggcggccggtt
tcactcgtgcgtgctcccgagggggtatcgggcgaactcttttttcagaagcattgggag
aaagagaacatgccggggatcgagcagcttgatccatcgctcgaccccgaccatcctccg
ctgctcgaagtttcaaccgctgaaggccttctttccgcagtgcagatgaacgtgatcgag
tttcatacgtggaacgccaccaagaatgtcattggcaagcctgacagaatcgcgttcgac
ctggaccccggcagcggagtcgaatgggccctcatccaggagtcggcgcagctcgtcaat
gtctttctcagggaactggggttgaaatcttttctgaaaacgagtgggggcaaaggcctg
cacatcgtcgtgccgatcaggaggctgcgtgattgggatacggtgaaaggtttctctcag
gccatcgtacagcatctggctaaaaccattccgacgcgtttcaccgcaaaaagcgggcct
cgcaaccgggtgggaaagatcttcatcgattacctgcgcaatgggttcggagccaccacc
gtatccgcctggtcagtacgcgcccggcctggattgggcgtttctgtaccgctggcgtgg
gaagagctgtcctcgctgaaaagcagtactcgctggtccgcttccaatattcatgaacgc
ctggataagggtaatgacccctgggccgactacgcagagacgaatcaatcgatagttcct
gccatgaaaaagctgggattcaccccttcatcaaaggcatga

DBGET integrated database retrieval system