KEGG   Nitrosospira multiformis: Nmul_A1832Help
Entry
Nmul_A1832        CDS       T00302                                 

Definition
(GenBank) Amino acid adenylation
Organism
nmu  Nitrosospira multiformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABB75129
UniProt: Q2Y7Z2
LinkDB All DBs
Position
complement(2110242..2115647)
Genome map
AA seq 1801 aa AA seqDB search
MTPRSIFHRIYPQNLVTHLRNLALARPTDLALTVMGQEGEGAVEKAFDYRTLDQHVRALA
AILQDRFSAGERALLLMENDEHYVIGFFACLYAGLIAVPVFPPEMVRERHLARLLAIAAD
AEARCILTTSEIMPLIARAAVEQFSYAIVLTVDTVKCDNASAWRECSPAEGDIAFLQYTS
GSTSTPKGVMVSHGSLMTNTRVFEEGMSINANDIFVSWLPLYHDMGLIGGLLQPIHRGIP
VVLMTPRFFIERPVRWLKAISHYRATVSGAPNFAFQLCADRVSDAQLQELDLSSWRVAFS
GAEPVRRETMKAFIERFAPAGFPPGTIYPCYGLAEATLFVTGGTRGDGMEAHCFSTQLLA
QGKVEVAEQGTSLVACGVPASGHTVRVVDPETGVQLPDGTIGEIWTDGASLACGYWRKPE
ETAETFVSREGGRWLRTGDLGFIHDGQLYIAGRRKDLIIIRGQNVYPQDLEQVIEDEVEA
ARKGRVAAFSVETENGEGIGMAVEISRGMQKLIAVETLVQALSEAVSGSCHEPLSVVVLL
NPGGLPKTSSGKLQRAACRQGWRERTLDAYAVYEFGNFVLGGSVRPVLTLTDDVEISLAG
LWETVLNRRGLGREDHFFASGGSSLSAVQAVARIAEHWQIDFTLRSLFENPKLRECAEEI
KRVLSVGTPRRTASIRILSTARRIGAADAAPLSFGQQRLWFLWQLDRTSTAYHIKQALRL
SGSLDAQALQASLDGLAARHESLRTVFRTGAEGSAEQVIQPAVRLHIPHIHLDDTPAFVR
EAYAKEEADRIISDPFDLTQGPLLRVVLIRLTQDEHILVMAMHHIISDGASMQVLLDELA
IGYMAHAQGQLPQFDPLPIRYADYAEWQRNWLEAGEKDRQLAYWRDCLGTEHPVLELPAD
HPRRPVANYQAAHHSFDLPPDVLSRLRSLAQRPDNRSATLFMALMAGFQALLYRLTGQKD
IRVGVPVANRNRTETRGIVGFFVNTQVLRGKIDSRMALSTLLAQVREAAIDAQAHQDLPF
EQLVEALQPERSLSRTPLFQVTLNHLVSDRRKLDQIKELKIVDYPLGEQAAQFELTLETI
ESPDGNVRASFIYASELFDIRTIERLGRQYVALLRALAGQPEITIGDVPLLSESDMAQLG
AWGAWGANAGAHLSGSAVFDRSAHPAAHEAARHAAHEPVHRRIERQAEERPNVCALIFND
TEITYQELNCRSNRLAHHLIALGVKAEVKVGITVERSIEMIVGLLGILKAGGAYVPLDPD
YPRERLDYLVEDSGIRLLLTQSPLRNRIPDSEKLSVLELDSVDVKGVAETNPEIALHPDN
LAYVIYTSGSTGRPKGVGVSHGPLAMHLAAIREIYDVRPGDRELMFFSMNFDAAAEQWIT
PLCEGGTLVLSSTRDLAGDGFVDQIGKHSITTLHLPPAYLRMLLPLMQDGAPSVRTCIAG
GEAWFAADLAATQAALPQARLVNAYGPTETVITPAAWVAHASETAEVRILHEFAPIGRAV
GDRKLYVLDEDLNIMPPGCAGELYIGGTGLARGYLDRPGLTADRFVADPFAPDGSRLYRT
GDRVRWRNEDNGGQLEYLGRLDHQVKLRGFRVELGEIEGQLLAQPGVREAAVVAKESRNG
TRLIAYVAAHHGVTLNASMLKTALAAVLPDYMLPGSFVLLDSLPLNPNGKVDRQALPLPL
AEQIDEAAYQTPVNAVETMISEIWAEVLELPRVGLHNNFFDLGGHSLLLIKVQCKLEERL
KTRIAIIDLFRYTTVASLAKFLGQEDRQADKGRLPLQRHQERAQRQRATFIQRRQRAGRT
H
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaaggtcaatttttcaccgcatttacccccaaaacctggtgacgcatctccgt
aatctcgcgttggcacgtcccacagacctcgccttgacggtaatgggccaggaaggcgag
ggagccgtggaaaaagcattcgactatagaacattggatcaacatgttcgtgcactcgca
gccattttgcaggaccgtttttcggcaggcgaacgcgccctgttgctcatggaaaatgat
gagcattacgtaatcggcttcttcgcctgtctttatgcaggcctcatcgctgtgcccgtt
tttccgccggagatggtgcgagaacggcatctggcacgcctgctcgccattgcagccgat
gctgaggcacgctgcatattgaccacgagcgaaattatgcccttgattgctcgtgccgcg
gtggaacagttttcttatgcgatcgtgctgactgtggacacggtgaaatgcgataacgcc
tccgcatggcgtgaatgttctcccgcagagggagatatcgcgtttttgcaatatacctcg
gggtctacatctacgcccaaaggggtgatggtgagccacggcagcctgatgacaaatacg
agagtgttcgaggagggcatgtcgatcaatgcaaacgacatattcgtgagctggttgccg
ctgtatcacgatatgggtctgatcggcggcttgctgcaacccatccatcggggcattcct
gtcgtgctgatgacgccccgattttttatcgaacgaccggtacgatggttgaaagccatt
tcgcactaccgtgcgacggtgagtggcgcgcccaattttgcgtttcaactctgtgcggac
cgggtaagcgatgctcagctacaagagctcgatttgtcgagctggcgtgtcgccttttcg
ggtgccgaaccggtacgccgggaaacgatgaaagcatttatcgaacgcttcgcaccggca
ggatttccacctggcacaatttatccctgttacggcctggccgaagcaacgctttttgtc
accggtgggacgcgtggagacggcatggaggcacattgcttctctacccagctgctcgcg
caaggcaaggtcgaagtggcggagcagggaacctctctggtagcttgcggtgtgccggct
tccggtcatacggtgagggttgtagatccggaaacaggtgtccaattgcccgatggtacg
atcggagagatctggacggatggtgccagtctggcttgcggctactggcgaaaaccagag
gagacagccgaaacttttgtttcccgcgaggggggacgttggctccgcaccggagacctt
ggcttcatacatgatggacagttatacattgcaggaaggcgcaaggatctcatcatcata
agggggcagaacgtctacccgcaggacctcgagcaagtgatcgaggatgaagtggaggcc
gcccggaagggaagggtggccgcgttttcggtagaaaccgaaaacggggaaggaatcggc
atggccgtggagatatcccgcggcatgcagaagcttatcgccgttgaaactctggtgcag
gcgttgagtgaggccgtgagcggaagctgccatgagccgctctcggtggtggtactactg
aatccgggaggattgcccaagacttccagcggaaaattgcagcgcgcagcctgccgccaa
ggctggcgcgagcgcaccctggacgcatatgccgtctatgagtttggcaatttcgtgctg
ggcggcagcgttcggcccgtactcacgctgacggatgacgtcgaaatttcgctcgcgggc
ctctgggaaaccgtgttgaatcgccgtgggttggggcgcgaggatcatttttttgccagc
ggcggaagctcactctcggcagttcaggctgtggcgcgtattgctgagcattggcagatc
gatttcacgctccgcagcctgttcgagaatccaaagttgcgcgagtgcgcagaggaaatc
aagcgcgtactgtcggttggcactcccagacgcactgccagcatccgcattctttccacc
gcaaggaggattggagcagccgatgcggcaccgctctcctttggtcaacagcgtctctgg
ttcctttggcaactggaccggacatccaccgcctatcacatcaagcaggcgttgcgattg
tcaggctccctggatgcccaggcgttgcaggccagccttgatgggctggccgcgcgccac
gaatccttgcgtaccgttttccggacaggagcggaaggttccgcggagcaggtgatccaa
ccggcagtgcggttgcatattccacacatccatctggacgacactcccgcctttgtgcgt
gaagcgtatgcgaaagaggaggccgaccggatcatttcggatcccttcgatctgacacag
ggcccgttgctgcgagtagtcctgatccggctgacgcaggatgagcacatcctggttatg
gccatgcatcacatcatctccgatggtgcctcgatgcaggtgttgcttgacgagctcgcc
atcgggtatatggctcatgcccaagggcagttgccgcagttcgacccgttacccatccgc
tacgcggactatgccgagtggcagcgcaactggctggaagcaggcgagaaagacaggcaa
ctggcctactggcgtgattgcctgggcaccgaacatccggtattggaattgccggccgat
catccgcggcggcctgtggcaaattatcaggcggcacatcattctttcgacctgccgccg
gatgtgctgagcaggctgcgaagccttgcccaacgcccggataaccgcagtgcgaccctt
ttcatggcgctgatggcgggttttcaagctttgctctatcgcctcacgggacaaaaggat
attcgtgtcggcgtgccggtcgccaatcgcaaccggactgaaaccagaggcatcgtcggt
tttttcgtgaatacccaggtactgcgcgggaagatcgacagccgcatggctttgtcaacc
ctgctcgcgcaggtcagggaggcggcaatcgacgcccaggcacaccaggatttgcccttc
gagcagttggttgaggcattgcagccggagagaagcctgagccggacgccgctgttccag
gtgacccttaatcatctggtaagcgaccgacgcaagctcgatcaaatcaaggagctgaag
atcgttgactatccgttgggcgagcaggctgcacagttcgagctgacgctggaaacgatc
gaatcacccgatggaaacgtgcgtgcaagcttcatctatgcgtcagagctcttcgatatc
cgcacgatcgagcgcctcggacgccagtatgtggctctgttgcgggcactggccgggcag
ccggaaataaccatcggcgatgtgcctctgttgagcgagagcgatatggcgcagctcgga
gcatggggagcatggggggcgaatgctggagcgcacctttcaggtagcgcggtgttcgat
cgatctgctcatccagccgcccatgaagctgcccgtcatgcggcccatgaacctgtacat
cggcgcatagagcgccaggcggaagaacgcccgaacgtctgcgccctgattttcaacgat
accgaaataacctaccaggagctgaactgtcgctcaaaccggctcgcacaccatttaatc
gctctgggagtcaaagcggaagtaaaggttggcattacggtagaacgttccatcgagatg
atcgtcggcctgctgggcattctcaaggcaggaggagcatatgtaccgctcgatcccgac
tatccgcgcgaacgcctcgactatctggttgaggatagcggcatccggttgctgttgacg
caatcccctctcaggaaccgtatccccgattcggaaaagctttcggtgctggaactggat
agcgtcgacgtgaagggggtagcagagaccaacccggagattgcgttacatcccgacaat
ctcgcttatgtcatctatacatccggatcgaccggcagaccgaaaggagtaggagtaagc
catggtcccctggcaatgcatctggcagcgatcagggaaatctacgacgtacgtcctggc
gatcgcgaactcatgtttttctcgatgaatttcgatgcggctgcggaacagtggatcacg
cccttgtgcgaaggtgggacgcttgtcctttcatcgacacgggatcttgctggcgacggt
ttcgtcgatcagatcggaaagcacagcatcaccacgctgcacttgccgcccgcttatcta
cggatgctgcttcccttgatgcaggacggtgccccgtcggtacgcacttgcatagccggc
ggcgaagcatggtttgcagccgacctggccgcaacgcaggcggctcttccgcaagcccgg
ctggtcaacgcgtacgggcctaccgaaacggtcatcactccagccgcctgggtagcccat
gcgtctgaaaccgctgaggttcgtattctccacgagttcgcgcccatcggccgtgccgtt
ggagatcgcaagttgtacgtactcgatgaggacttgaatatcatgcctcccggctgtgcc
ggagaactctatatcggtgggacaggacttgcccgcggataccttgatcgtcccggtctc
accgcagaccgcttcgttgccgatcctttcgcaccggatgggagccgcctttaccgcacg
ggggatcgcgtgcgctggcgcaatgaggacaatggcggccaactcgaatacttgggccga
ctcgatcaccaggtcaagcttcgcggctttcgggttgaactgggcgaaatcgaggggcag
ttgctggcccagcccggagttcgcgaggcggcggtagtggcaaaggaaagccgcaatgga
acgcgtctcatcgcctacgtcgccgcgcatcacggcgtaacactcaatgcatccatgctc
aagactgccctggctgctgtgcttccggattacatgctgcctggttcgtttgtgctgctc
gatagtctgccgctcaaccccaatggcaaggtcgatcgccaggcgttgcccttgcccctg
gcggagcagatcgatgaggcggcctatcagacgcccgtcaatgccgtggaaacgatgatt
tcggagatctgggcggaagtcctggagctaccccgagtggggctgcacaacaattttttc
gatctgggcgggcattcgctgctgctcatcaaggtgcaatgcaaactggaagagcggttg
aaaacacgcatcgccatcatcgatcttttcagatataccaccgtcgcgagcctggccaaa
tttctcggccaggaggacaggcaggcggataaggggcgtctgcccttgcagcgccatcag
gaacgggcgcagcggcagagagcgacgttcatacaacgcaggcagagagcagggaggacg
cattaa

DBGET integrated database retrieval system