KEGG   Nitrosospira multiformis: Nmul_A1944Help
Entry
Nmul_A1944        CDS       T00302                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00790  Folate biosynthesis
nmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmul_A1944
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmu03016]
    Nmul_A1944
Enzymes [BR:nmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     Nmul_A1944
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     Nmul_A1944
Transfer RNA biogenesis [BR:nmu03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Nmul_A1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS FAM83
Motif
Other DBs
NCBI-ProteinID: ABB75239
UniProt: Q2Y7N2
LinkDB All DBs
Position
2235989..2236438
Genome map
AA seq 149 aa AA seqDB search
MLITRRLEFDAGHRIPSHKSQCRHLHGHRYAIEITLSGEIITEPGISEQGMVMDYSEVKR
IAKEVLVDKWDHAFLAYAEDHKLLEFLQSLEDHKTVVLDTPPTAENLALTAFYILDEAYQ
DRYGNHLRLEQVRLFETPNCWADAVRGQP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttgattacacgcaggctggaattcgacgccggccatcgtataccttcccacaagagc
cagtgccggcatctgcacggccatcgttacgccatagaaattaccctgtcaggcgaaatt
atcactgagcctggcatctccgagcaaggcatggtcatggattattcggaggtcaaacgc
attgcgaaagaagtgctggtggataaatgggaccatgcgttccttgcctatgcggaagac
cacaagttgctggaattcctccaatccctcgaagaccacaaaaccgtggtgctggatacg
ccccccacggcggaaaacctggctctgaccgctttctacatactcgatgaagcatatcag
gatcgctatggcaatcatctaaggctggagcaagtgcgcctgttcgaaacccccaactgc
tgggcggatgcggtgcgaggacaaccctga

DBGET integrated database retrieval system