KEGG   Nitrosospira multiformis: Nmul_A2491Help
Entry
Nmul_A2491        CDS       T00302                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00473  D-Alanine metabolism
nmu00550  Peptidoglycan biosynthesis
nmu01100  Metabolic pathways
nmu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nmul_A2491
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nmul_A2491
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Nmul_A2491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmu01011]
    Nmul_A2491
Enzymes [BR:nmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Nmul_A2491
Peptidoglycan biosynthesis and degradation proteins [BR:nmu01011]
 Precursor biosynthesis
  Amino acid ligase
   Nmul_A2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp RimK ATPgrasp_ST ATP-grasp_4 TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABB75780
UniProt: Q2Y641
LinkDB All DBs
Position
complement(2845713..2846633)
Genome map
AA seq 306 aa AA seqDB search
MAGSHDFGKVAVLLGGRSAEREISLESGKAVLDALRSSGVDAHPFDPSEQHMDALLQQGY
TRAHIALHGRYGEDGTVQGALELLGIPYTGSGVLASALAMDKWRTKLLWQSAGINTPRHI
LLDEQSDFDAVAKELGLPLIVKPSREGSTIGLSKVREAGEVAAAWHLAARHDAMVLAEQF
IEGTELTASILGDVALPLVRIQVEGDLYDYQAKYLSDKTQYFCPSGVSEEQECLIRKQAL
QAHRLLGCEGWGRVDLILDKSGTPYFLEANTSPGMTTHSLVPMAAKAAGISFEELVLKIL
GLAHVG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtagtcatgacttcgggaaggtcgcggttctcctcggaggacgatcagcggag
cgcgagatttcccttgaaagcggtaaagccgtactcgatgctctgcgcagctccggggtg
gacgctcatccattcgacccctccgaacagcacatggacgcgcttttgcagcaagggtat
acgcgcgctcatatcgccctccatggccgttatggtgaggacggaacagtccagggcgcg
ctggaactgctggggattccctataccgggagcggcgtgctggccagcgccttggcgatg
gacaaatggcgtaccaaattgctctggcagtccgcgggcatcaacacgccgcgccatatc
ctgctcgatgagcagagcgattttgatgcagtggcaaaagagttgggcctgccgctgatt
gtaaaaccttcgcgagagggttccaccattggtctgagcaaggtcagggaagcaggggaa
gtcgctgccgcatggcatcttgctgcccgccatgatgccatggtgctggcggagcagttt
atcgaaggaaccgaactcacggcttctattctcggagatgtagcgttaccgctggtgcga
attcaggtcgagggtgatctgtacgactaccaagccaaatacctgtcggacaagacgcag
tatttctgcccgagcggcgtgtccgaggagcaggagtgcctcattcggaaacaggcattg
caggcgcacagactgttgggctgcgaaggttggggaagggtggatttgatactggataaa
tcgggcactccctattttctcgaagcgaacacctcccctgggatgaccacccatagtctc
gttcccatggcggcaaaagcggcaggaatatccttcgaggagctggtgctgaagatactg
ggactggcccatgtgggataa

DBGET integrated database retrieval system