KEGG   Nitrosospira multiformis: Nmul_A2691Help
Entry
Nmul_A2691        CDS       T00302                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00620  Pyruvate metabolism
nmu00680  Methane metabolism
nmu01100  Metabolic pathways
nmu01120  Microbial metabolism in diverse environments
nmu01200  Carbon metabolism
Module
nmu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nmul_A2691
  09102 Energy metabolism
   00680 Methane metabolism
    Nmul_A2691
Enzymes [BR:nmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nmul_A2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABB75978
UniProt: Q2Y5J3
LinkDB All DBs
Position
3091269..3094082
Genome map
AA seq 937 aa AA seqDB search
MASLASPSESIDTNPNYIHDKEPKDDPLREDIRLLGRMLGDTLREQEGEPTFDLVENIRQ
TAIRFRRDQDPKARQELDRLLNQLSNKATEAVVRAFSQFSQLSNIAEDMHHNRRRRSYLL
ARSQPQAGSVARALDLVFSKETSSAALGRFFDKALVSPVLTAHPTEVQRRSILDCQLAIA
RLLNERDRVQLTPDELSKNEEGLRTNIQILWQTRMLRSARLSVYDEIKNGLAYYHYTFLT
EVPHLYAEIEDLLERRMGDKAPRIPPFLRIGSWIGGDRDGNPFVTHEVLLHAAERQSALA
LDFYMGEVHRIGRRLSLTDRLVDVDEALAALAEASPDRAPSRADEPYRRALIGIYARLAA
TSMGLGHAIRQRRPVGPAEPYTDSLELVRDLDIVIHSLEQHKSELLARGDLRRVRRAAEV
FGFHLAPLDMRQHSHIHEQVVAELFERGANLKGYSDLPEAERVRCLLTEVSSPRLLRSPY
LDYSELAQSELHIVETAAEIHRRFGPAALPNYVISKADGISDILEVALLLKEVGLLRAGE
KPCLHINIVPLFETIADLRGCARIMDELFSIPYYRKLVDSRNDVQEVMLGYSDSNKDGGF
LAANWELYKAETELTKVFAKHKVELRLFHGRGGTVGRGGGPSYQAILAQPPGSVNGQIRI
TEQGEVIGSKYSDPEIGRRNLETLVAATIEATLLSHDTLGQCADEYYGVMEVLAGDALRA
YRSLVYETPGFNRYFQESTPIKEIAGLNIGSRPPSRKKSDLIEDLRAIPWTFSWGVNRAM
ITGWYGFGTAVEMFVQREGKGDNGLGLLQKMYQAWPFLQTLLSNMDMVLAKTDMGIASRY
AELVTDVELRREVFGRIQKEWELSVKWLFAVTGRTELLQDNPTLARSIRNRTPYIDPLNH
LQVELLRRYRSGDATDAVTRAIQLTINGVAAGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctcgcttccccaagcgaaagtattgatactaaccctaattacatccatgac
aaggaaccgaaggatgatcctctgcgcgaggacatccgcctgctcggacgcatgctgggc
gacaccctgcgtgaacaggagggcgagcctacttttgatctggtagaaaatattcgccag
acagctatccgatttcgccgcgaccaggatccgaaggcgcgacaggaactggacagactg
cttaatcagttgagcaacaaggctaccgaagcagttgttcgcgcattcagccagttctcg
cagctatcgaacatcgccgaggatatgcatcacaaccgccggcgtcgaagctacctttta
gcccggtcgcaaccacaggcgggcagtgtcgcgcgcgcgctcgacctggttttctccaag
gaaacaagcagcgcggcccttggccggttctttgacaaagcgctcgtttcgccggtgttg
acagcccatccgacggaagtgcagcgaagaagcatacttgactgccagttggcaattgct
cgcttgttgaacgagcgcgaccgggtgcagctcaccccggatgagctaagcaagaacgaa
gagggattgcgcaccaacattcaaatattatggcagacgcgcatgctgcgctcggcgcgt
ctgtccgtatatgacgaaatcaaaaatggcctggcctattatcactatacttttcttaca
gaagtgccgcatctgtatgcggaaatcgaagatctgcttgaacgccggatgggcgataaa
gctccccgtattcctccgtttcttcgtatcggcagctggataggcggcgaccgcgacggc
aatcccttcgttactcatgaggtattactgcacgccgccgagcggcaatccgccctggca
ctggatttttacatgggcgaggtccaccggatcggccgccggttaagcctgactgatcgc
ctggtcgacgtggacgaagccttggcggcgttggccgaggcttcgcccgatcgggcgccg
agtcgcgctgatgagccttatcgccgcgccctgatcggtatttacgcgcgcctcgctgcc
accagcatggggctcggtcacgccatcaggcaacggcgcccggtcggtccggcggagcct
tacactgacagcctggaactcgtgcgcgatctcgatatcgtcatccattcgctcgaacaa
cataagtcggagttactcgcgcggggcgatctacgtcgcgtgcggcgggcggccgaagta
ttcggttttcatctcgcgccgttggacatgcgccagcacagccacattcatgagcaggtc
gtggccgaactgttcgaacgcggcgccaacctgaaaggctattcagatctgccggaagca
gaacgtgtgcgctgtctcctgaccgaagtcagcagtccgcgtcttctgcgctcgccttac
ctcgactattccgagcttgcccagagtgaattgcatatcgtggagacggcggccgaaatc
caccgacgttttggtccggcggcattgcccaattacgtcatttccaaagctgatgggata
tccgacatcctggaagtggcgctgctgctgaaagaagtaggactgctgcgggcaggagaa
aaaccctgcctgcatatcaacattgttccattgttcgaaaccattgccgacctgcgtgga
tgtgcccgcatcatggatgaattgttctcgatcccttattaccgcaagctggtggattcg
cgcaatgacgttcaggaagtgatgctcggctactccgatagcaacaaggatggcggattc
ctcgcagccaactgggaactttacaaggccgaaaccgaactcacgaaggtctttgccaag
cataaagtcgagctgcggctgttccatggacgcggcggcacggtcggacgcggcggcgga
cccagctatcaggcaatactggcgcagccgccggggagcgtcaacgggcagatacgcatc
accgagcagggcgaggtcatcggcagcaaatattccgatccggagatcggacggcgtaat
ctggaaacgctggtcgcagcaaccatcgaggcgacgctgctgagtcatgatacgcttggc
caatgcgcggatgaatattatggagtcatggaagtactggcaggcgatgccctgcgggct
tatcgcagcctggtatacgagacccccggatttaaccggtattttcaggaatcgactccg
ataaaggaaatcgcgggactcaatatcggcagccgtcccccttcccgcaaaaaatccgac
ctgatagaggatctgcgtgccattccatggacgttcagctggggtgtcaaccgcgcgatg
attaccggctggtatggtttcggcaccgcagtggaaatgttcgtgcagcgcgaaggcaag
ggcgacaacggactgggactcctgcagaaaatgtatcaagcctggccgttcctgcagaca
ttgctgtcgaacatggacatggtgctcgccaaaactgacatgggtattgcttcgcgctac
gctgaacttgttacggatgtggaactgcggcgcgaagttttcgggcggatacaaaaagaa
tgggaacttagcgtgaaatggctttttgccgtgaccggtcgaactgaactattgcaagat
aaccccacgctggcgcgcagcattcgcaatcgtaccccttatatcgatccactcaatcat
ttgcaggtggaactgttgcgccggtaccggtccggggacgctacagatgcggtaacacgc
gccatccagcttactatcaacggagttgccgccggattgaggaacagcgggtaa

DBGET integrated database retrieval system