KEGG   Nitrospira moscoviensis: NITMOv2_0598Help
Entry
NITMOv2_0598      CDS       T04041                                 

Gene name
pepM
Definition
(GenBank) Phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nmv  Nitrospira moscoviensis
Pathway
nmv00440  Phosphonate and phosphinate metabolism
nmv01100  Metabolic pathways
nmv01120  Microbial metabolism in diverse environments
nmv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    NITMOv2_0598 (pepM)
Enzymes [BR:nmv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     NITMOv2_0598 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD Pantoate_transf
Motif
Other DBs
NCBI-ProteinID: ALA57034
UniProt: A0A0K2G853
LinkDB All DBs
Position
complement(567783..569462)
Genome map
AA seq 559 aa AA seqDB search
MNNAAKLRALLKRPGAIKAVGAHDALSARLIERAGFDAIWASGFAISASLKCIPDASFIT
SSEQLEVERNIAEAVSIPIIADCDTGYGNALNVMRTVNDRERAGVAAICIEDNVYPKRCS
FYAGVRRELIPIEEHCGKIKAAKAAQIYPEFVVIARTEALIAGWGQEEALKRAEAYAEAG
ADAVLIHSKSKKFDELKAVYKAWSGRVPLVVVPTIFDQTTAAEMEEAGAKIIIYANQPVR
AAIRAMRDTLDIIKKDTRPGAANDRIVTLPEVYDIVGVPRMEEDEKQFLPVGGEKITAII
AAAGFEKQLLPLIEDKPKCLLDIKGKTILERAVGALNECNIKDIALIRGYKKEAIALPNI
RYYDNDRYEDTGELYSLFCAENELKGRTLILYGDIIFDTAILEKLLKSPADIALVVDVAW
LDQEQRGAQPTHLNPDLVSLAEPPGKSYLSRFVIPEGEHRIVRIGQQLPREQAHGEFIGM
AMFSEKGTQAFRECYKAAQASQASAGFHESRSLSKASFTDLIQEMINRGHTVQAVPIFKG
WMEVDSFEEYQKAWAKIRQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgcggcgaagttgcgagccctgctcaagcggcccggcgccatcaaggccgtc
ggcgcgcacgacgcgctgagcgcgcgtctgatcgaacgggccggcttcgacgccatctgg
gccagcggcttcgccatctcggcctcgctcaagtgcattccggacgcgagcttcatcacc
tccagcgagcaattggaagtcgagcggaacatcgccgaagcggtctcgattccgatcatc
gccgactgcgacaccggctacggcaatgcgctgaacgtgatgcggacggtcaacgatcgc
gagcgggccggcgtggccgccatctgcatcgaagataacgtctaccccaaacggtgcagc
ttctacgcgggcgtccgccgggagctgattccgatcgaggagcactgcggcaaaatcaag
gcggccaaggccgcgcagatctatcccgagttcgtggtcatcgccaggaccgaagcgctc
atcgcgggctggggccaggaggaagccttgaagcgggcagaggcctacgccgaggcgggc
gccgacgcggtcctgatccactcgaagtcgaaaaagttcgacgagctgaaggccgtgtac
aaagcctggtccggccgcgtaccgctcgtcgtcgtgcccacgatcttcgatcagacgacc
gcggccgaaatggaagaggccggcgcgaagatcatcatctacgccaatcaaccggtccgg
gccgcgatccgcgccatgcgcgacacgttggacatcatcaagaaagacacgcgcccgggc
gcggcaaacgaccggatcgtcaccttgcccgaggtgtacgacatcgtcggcgtcccccgg
atggaagaagacgaaaagcaattcctgccggtgggcggcgagaagatcaccgccatcatc
gccgcagccgggttcgaaaagcagctgctcccgctgatcgaagataagccgaagtgcctc
ctcgacatcaagggtaaaaccatcctggaacgggccgtcggcgccctcaacgaatgcaac
atcaaggacatcgccctgatccgcggctacaagaaggaggcgatcgccctcccgaatatc
cgttactacgacaacgaccggtacgaagacacgggcgagttgtattcgttgttctgcgcg
gaaaacgagctgaaaggccgcacgctgatcctctacggcgacatcatcttcgacacggcg
attctggaaaagctgctgaagagccccgccgacatcgcgctggtggtcgatgtagcctgg
ctggatcaggaacagcggggagcgcagccgactcacctgaatcccgacttggtgtcgctc
gccgagccgccgggcaagagctacctgtcacggttcgtcatcccagaaggcgagcaccgc
atcgttcggatcggccagcagcttccccgcgagcaggcccatggcgagttcatcggcatg
gcgatgttttccgaaaaggggacgcaggcgttccgcgagtgttacaaggcggcgcaggca
agccaggcttcggccggcttccacgagtcgcggagcctcagcaaagcttccttcaccgat
ctcatccaggagatgatcaatcggggccatacggtccaagccgtcccgattttcaaaggc
tggatggaagtcgactccttcgaggaataccagaaggcctgggccaagatccgccagtaa

DBGET integrated database retrieval system