KEGG   Nitrospira moscoviensis: NITMOv2_2657Help
Entry
NITMOv2_2657      CDS       T04041                                 

Gene name
ykoU
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nmv  Nitrospira moscoviensis
Pathway
nmv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nmv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NITMOv2_2657 (ykoU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nmv03400]
    NITMOv2_2657 (ykoU)
Enzymes [BR:nmv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NITMOv2_2657 (ykoU)
DNA repair and recombination proteins [BR:nmv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NITMOv2_2657 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ALA59070
UniProt: A0A0K2GDN5
LinkDB All DBs
Position
complement(2500491..2503178)
Genome map
AA seq 895 aa AA seqDB search
MPRPATNDLDRYRRKRDFQRTPEPSGRLARQAVAAPAGRPLFVVQKHAASRLHYDFRLEL
DGTLKSWAVPKGPSLDPAQKRLAVHVEDHPLEYAEFEGVIPPKQYGAGTVLVWDRGTWEP
LSDPREGYRRGVLKFRLRGEKLHGGWTLVRMHRRGGEDEDNWLLIKERDADAKSGPAGEI
VETLPDSVASGRGIEQVKGARARVWQSNRSSALSRQPPPALSAPPSGRGTRHLPFATHHA
SRITLHPASVPGAVKRACPDWIAPQLASLVNGMPAGEGWLHEIKYDGYRIVSRVERGTAR
LYSRNRNDWTSRLRPQAEALAALGLDEAWLDGEVVVLDAGGKPDFQALQNAFDLEAPRPI
VYCLFDLMYLNGYDLRGAPLAERKRLLAALLPDGRDGATLRYSDHLVDRGREVFVEACRS
GLEGVIAKRADASYRSGRGSSWLKIKCERRQEFVIGGYTDPSGSRHGFGALLVGYYDGDE
LRYAGKVGTGFSETSLRELSARLTRLTQRRPPFVNPPSGSEARGVHYVRPQLVAEVRFAE
WTQEGILRQPSFQGLRQDKPARAIGREWPQEEQGDSNGGTRGSNGGKGGKGDNGGTRGNR
REQGTTVRLSHPDRVLYPDMGLTKEGLARYYEAVAEWIVPHLRGRPLTLVRCPEGYQDCF
YQKHINETVPKAIQRIEIEEDDGIGTYMIADSLEAVLGLVQMGVLELHTWGATRDRLEQP
DRLTFDLDPDPSVPWEQVIEAAQLTRTLLDELGLVSFVKTTGGKGLHLVTPIERTCAWDE
AKAFAKSVADHMARTIPQRFTANMAKRARKGKIFIDYLRNARGATAIAAYSTRAKPGAPV
SVPLAWDELSPELKSDSFTVTNVPGRLKSLRADPWEGYRDATRRITERMKRRLAP
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccggcgacgaacgatctggatcggtatcggcgcaagcgggactttcagcgg
acgccggagccgagcggccgtcttgcccggcaagccgtcgctgcgccggccggccggccg
ctgttcgtcgtgcagaaacatgccgcctcgcggctgcactacgacttccggttggagctc
gacgggacgctgaaaagctgggccgtgcccaaagggccgagcctcgatccggcgcaaaag
cgcctggcggtgcatgtcgaggaccatccgctcgagtatgccgagttcgaaggcgtcatc
ccgccgaagcagtacggggccgggacggtgctcgtgtgggaccgcgggacctgggaaccg
ctgagcgacccgcgggagggctatcggaggggcgtgctgaagttccggctgcgcggcgaa
aaattgcacggcggctggacgctggtgcgcatgcaccgccggggcggcgaagacgaagac
aactggctgctcatcaaggagcgggatgcggacgcgaagtccggaccggcgggcgagatc
gtcgagacgctgccggacagcgtggccagcgggcgcggcatcgagcaggtgaagggcgcg
cgggcccgggtctggcagtcgaaccggtcttcagctctcagccgtcagccgccgccagcg
ctcagcgctccgccctccgggcggggcacccggcacttgccgttcgccacgcatcacgca
tcacgcatcacgcttcacccggcttctgtgcccggcgcggtgaagcgcgcctgtccggac
tggatcgcgccgcagttggcgagtctcgtgaacggcatgccggcgggcgaaggttggctg
cacgaaatcaagtatgacggctatcgcatcgtcagccgggtggagcggggaacggcccgg
ctctacagccgaaaccgcaacgattggacgagccgcctgcgtccgcaggccgaggcgctg
gcggcgctcggcctggacgaggcgtggctcgacggtgaggtcgtcgtgctggacgccggc
gggaagccggatttccaagccctgcaaaacgccttcgatctcgaggcgccccgtcccatc
gtctattgcctgttcgatctcatgtatctcaacgggtatgacctccgcggcgcgccgctg
gccgagcgcaagcgcctgctcgccgcgttgctccccgacggccgcgacggggccacgctg
cggtacagcgatcacctcgtcgatcggggacgggaggtgttcgtggaagcctgccgcagc
ggcctcgagggcgtgatcgccaaacgcgccgacgcctcctatcggtccgggcgcgggtcc
agttggctcaagatcaaatgcgagcggcggcaggaattcgtcatcggcggttataccgat
ccatcgggatcgcgccatggattcggcgcgttgctggtcggctattatgacggagacgaa
ctgcgctacgcgggcaaggtcggcacgggattctcggagacgtcgttgcgcgagctcagc
gcccggctgacccgtctgacacagcggcggccgccgttcgtcaatccgccctccggttcg
gaggcgcgcggcgtccattatgtacggccgcagctggtggccgaggtgcggtttgccgag
tggacgcaggaggggatcttgcgccagccgagtttccaaggcctgcggcaagacaagccg
gcgcgcgccatcgggcgggaatggccgcaggaggagcaaggggatagtaatgggggtacg
cggggtagtaatgggggtaaagggggtaagggggataacgggggtacgcggggtaatcga
agggagcaggggacgactgtgaggctgagccatcccgatcgggtgctgtatccggatatg
gggctcaccaaggaaggactggcccgctattacgaagccgtcgccgagtggatcgtgccg
cacttgcgcggacggccgctgacgttggtccggtgtccggagggctatcaggactgtttc
taccagaagcacatcaacgagaccgtgccgaaagccatccagcgcatcgagatcgaggag
gatgacggaatcggcacctacatgatcgcggattcgctggaggccgtgctcggcttggtc
cagatgggtgtcttggagctgcacacctggggagccacgcgcgatcggttggaacagccc
gatcggctcacgttcgatttggaccccgatccatccgtcccctgggagcaggtgatcgaa
gcggcgcagctcacgaggacgctgctggacgaattgggactggtgagttttgtaaagacg
accggcgggaagggcctgcatctcgtgacgccgatcgaacggacgtgtgcgtgggacgag
gcgaaggcctttgcgaagtccgtcgccgaccacatggcgcggacaatcccgcagcgtttc
acggcgaacatggcgaaacgcgcgcggaagggcaaaatcttcatcgactatttgcgcaac
gcgcgcggcgccacggcgatcgccgcctattcgacgagggcgaagccgggcgcgccggtg
tccgtgccgctggcctgggacgaactgtcgccggaactcaagtccgactccttcacggtt
accaacgtgccgggtcgtctgaagagcctgcgggcggatccctgggaagggtaccgagac
gcgacgcgccggatcaccgagcggatgaagcgacggctggcgccataa

DBGET integrated database retrieval system