KEGG   Nitrospira moscoviensis: NITMOv2_3228Help
Entry
NITMOv2_3228      CDS       T04041                                 

Definition
(GenBank) putative Multidrug resistance protein A (Modular protein)
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
nmv  Nitrospira moscoviensis
Brite
KEGG Orthology (KO) [BR:nmv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nmv02000]
    NITMOv2_3228
Transporters [BR:nmv02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   NITMOv2_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 Biotin_lipoyl GAS
Motif
Other DBs
NCBI-ProteinID: ALA59625
UniProt: A0A0K2GF88
LinkDB All DBs
Position
3029911..3031413
Genome map
AA seq 500 aa AA seqDB search
MSTTHSVPPPAPHLYEESLHAQRNRRLLLVALVLALAGLAYGVYWWTTARYWIQTDNAYV
TGNLVPVAAQASGIITQVLFEETQFVNRGDVMIRLDEHEAYAALGRARGRLGDTVRRINS
LFFTQRQLAEKLAARRARLDVIRHDVDRYRRAAPSGAVSKQILQNALDQLQALDADVRET
QAEYDALDAQIGGTTVMEHPAVELAKHEFINAHLEYARQQIRAPVSGYVAKRKAQVGDRV
KPGTNLMTIVPLDHLWVEANLRETELRDIRPGQPAEVRVDLYGDRHTFHGTVEGLVPGTG
SPFALLPPDNSTGNFIHITERVPVRIALAADEIREHPIRPGLSTVTKIRVSDAGNSVWTS
LAKADTEEYHTDVYGDELTSAELLAQGVIAGNVRVTGQGLNVAAGRPVGLDSTAPHDPTT
LSDLGRSADGLYEGPRRSPPDVEPHSSVPPRSPDLGEAFFPLSPSIGPGSDRLGPAAGPP
PAVPEPLDRRRSGERNLTDR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacccattccgtcccccctccggcgccccatctgtacgaagaatcgctgcat
gcccagcgcaatcggcgcctcttgctcgtggccctcgtgctggccctcgccggcttggcg
tacggcgtctattggtggacgacggcacggtattggattcagaccgacaatgcctatgtc
accggcaacctcgtgccggtcgcggcgcaggccagcggcatcatcacgcaggtcctgttc
gaggaaacgcaattcgtgaaccggggcgatgtgatgatccgtctggacgagcatgaagcc
tatgcggcgttgggtcgcgcgcggggccggctgggcgacacggtccgccggatcaactcg
ctgttcttcacgcagcgccaactggcggaaaaattggccgcccgccgggcccggctggac
gtgatccggcatgacgtggaccgctatcgccgcgcggcgccgagcggggccgtctcgaag
cagatcttacagaacgcgctcgatcagttgcaggcgctggacgccgacgtgcgggagacg
caggccgaatatgacgcgctcgacgcgcagatcggcggcaccacggtcatggaacacccg
gccgtcgagctggcgaagcacgagttcatcaacgcgcatctcgaatacgcgcggcagcag
atccgcgccccggtgtccggctacgtcgccaaacgcaaggcgcaagtcggcgaccgggtg
aagccgggcacgaatctcatgacgatcgtcccgctggaccatctgtgggtggaagccaac
ttgcgggagaccgaattgcgcgacatccggcccggacaaccggccgaagtgcgcgtggat
ctctacggcgacagacatacgtttcacggcacggtggaaggcctcgtgccgggcaccggc
agcccctttgccctgctgccgcccgacaattccacgggcaacttcatccacatcaccgag
cgggtccccgtccgcatcgcgctcgccgcagacgaaatccgcgagcatccgatcaggccg
ggcctctcgaccgtcacgaagatccgcgtcagcgacgcaggcaattcggtctggacgtct
ctcgccaaagccgacaccgaggagtatcacacggacgtctacggagacgagttgaccagc
gcggaactgctggcgcagggcgtcatcgccgggaacgtacgcgtcacaggccagggtctg
aacgtggccgccggccgcccggttggattggattccacggcgccccacgatccgacgacg
ctctcggacctcggtcgttcggcagatggattgtatgagggaccgcgccgctccccacct
gacgtagaaccgcactcctctgtcccgcccagaagcccggatctgggcgaggctttcttt
cccctctccccctcgatcggcccggggtcggaccgcttgggtccggccgccggtccgccg
cccgccgttcccgagccgctcgatcgacggcgatccggagaaaggaatctcacggatcga
tga

DBGET integrated database retrieval system