KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0330Help
Entry
NMAA_0330         CDS       T01931                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase (SK)
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01130  Biosynthesis of antibiotics
nmw01230  Biosynthesis of amino acids
Module
nmw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMAA_0330 (aroK)
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NMAA_0330 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 TsaE AAA AAA_22 PduV-EutP Cytidylate_kin AAA_5
Motif
Other DBs
NCBI-ProteinID: CBY90177
LinkDB All DBs
Position
complement(400104..400616)
Genome map
AA seq 170 aa AA seqDB search
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPTIFEMEGEQGF
RSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYLHAPPETLLERTRCDNS
RPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQTLLKRLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttaacggcaaactcatcctcatcggactgatgggcgcgggcaaaaccacg
ctgggccggcaaatggcgcagcggctggattaccgtttttacgacagcgatcacgaaatc
gccgcagccgccggcgttcccatccccaccatatttgaaatggaaggcgaacagggattc
cgttcgcgcgaaaccgccatactcaaaaagctggttatcctgccccatatcgtcctgtcc
accggcggcggcgcggtgttaaaagaagaaaaccgcgcccttatccgcaaaagcggcacg
gtcgtctatctgcacgccccgcccgaaaccctgctcgaacgcacgcgctgcgacaacagc
cgtcctttgctgcaagttgccgatcctttggcgaaattacgtgaactctacgccgcacgc
gaccccgtttaccgccaaaccgccgactttaccgtagaatcggcaaactgccgggaaacc
gtgcaaaccctgctcaaacgcttatcccgataa

DBGET integrated database retrieval system