KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1487Help
Entry
NMAA_1487         CDS       T01931                                 

Definition
(GenBank) putative mutator MutT protein (7,8-dihydro-8-oxoguanine-triphosphatase; 8-oxo-dGTPase; dGTP pyrophosphohydrolase)
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Brite
KEGG Orthology (KO) [BR:nmw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nmw03400]
    NMAA_1487
Enzymes [BR:nmw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     NMAA_1487
DNA repair and recombination proteins [BR:nmw03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    NMAA_1487
 Prokaryotic Type
    NMAA_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: CBY91421
LinkDB All DBs
Position
complement(1739858..1740667)
Genome map
AA seq 269 aa AA seqDB search
MIQDTRPLIRVVAGILLDSDGNYLLSSRPEGKPYAGYWEFAGGKVEAGETDFQALQREFE
EELGIRILAATPWLTKIHSYEHARVCLKFLWVNPGQWTGEPQSREGQEWSWQKAGDFTVA
PMLPANGALLRSLSVPRRLYGSLKTGLHGENSMGAYRVLPLGSAEGSGANVLMEAAQWQD
RPEHADSVWMMVQTREQWRQAQEKGADVVVWRVCNDVQAQEAAEALRQGVSVPLVLAANG
QTVARYGKLWLGLGAHVVVRDETIGKNHE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagacacccgaccccttatccgcgtcgttgccggcatcctgctcgattcagac
ggcaactacctgctcagctcgcgccccgaaggcaaaccctatgccggatattgggaattt
gccggcggcaaggtcgaagcgggcgaaaccgacttccaagccttgcaacgcgagtttgaa
gaagaactcggcatccgcatccttgccgccacgccttggctgaccaaaatccattcctac
gaacacgcccgcgtctgcctgaaattcctatgggtcaaccccggccaatggacgggcgaa
ccgcaatcccgcgaagggcaggaatggtcttggcagaaggcgggtgattttaccgttgcc
cccatgctgcccgccaacggcgcgcttttgcgttcgctgtccgttccgcgccgtttgtac
ggcagcctgaaaacgggtttgcacggggagaacagtatgggcgcgtaccgcgtcctgcct
ttgggttcggcagagggaagcggtgcgaacgttttgatggaggcggcgcaatggcaggac
agacccgaacacgccgacagcgtgtggatgatggtgcagacccgcgaacaatggcggcag
gcgcaggaaaagggcgcggatgttgtcgtgtggcgcgtgtgcaatgatgttcaggcacaa
gaggcggcagaagccctgcggcagggcgtatccgtgccgctcgtacttgcagcaaacgga
cagacggttgcacgttatggaaaactatggctcggattgggggcgcacgtggtggtaagg
gatgaaacaatagggaagaatcatgaataa

DBGET integrated database retrieval system