KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_0896Help
Entry
NMA510612_0896    CDS       T03438                                 

Definition
(GenBank) sensor histidine kinase
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nmx01001]
    NMA510612_0896
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nmx02022]
    NMA510612_0896
Enzymes [BR:nmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NMA510612_0896
Protein kinases [BR:nmx01001]
 Histidine kinases
  OmpR family
   NMA510612_0896
Two-component system [BR:nmx02022]
 OmpR family
  Unclassified
   NMA510612_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_5 DUF3160 GD_AH_C YlqD
Motif
Other DBs
NCBI-ProteinID: AHW75198
UniProt: X5F7R7
LinkDB All DBs
Position
complement(790044..791450)
Genome map
AA seq 468 aa AA seqDB search
MKLFQRIFATFCAVIVCAIFVASFSFWLVQNTLAENQFNQRRTIETTLMGSIISAFRARG
DAGAREILTEWKDSPVSSGVYVIQGDEKKDILNRYIDSYTIERARLFAAGHPHSNLVHIE
YDRFGEEYLFFTKDWDKLQARRLPSPLLIPGLPLAPIWHELIILSFIIIVGLLMAYILAG
NIAKPIRILGNGMDRVANGELETRISQQVDDRDDELSHLAIQFDKMVEKLEKLVAKERHL
LHHVSHEMRSPLARMQAIVGLIQAQPQKQEQYLKRLEGELTRMDTLAGELLTLSRLETSN
MALEKESLKLLPFLGNLVEDNQSIAQKNGQTVTLSADGKIPENTTILANESYLYRAFDNV
IRNAVNYSPEGSTILINIGQDHKHWIIDVTDNGPGVDEMQLPHIFTAFYRADSSANKPGT
GLGLALTQHIIEQHCGKIIAENIKPNGLRMRFILPKKKTGSKTEKSAN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttccaacgcatcttcgccacattttgcgcggttatcgtctgtgcaatcttt
gtggcgagtttttctttctggctggtgcagaacacccttgccgaaaaccagttcaaccaa
cgccgcaccatcgaaaccactttgatgggcagcatcatttccgcattccgggcacgcggg
gacgcgggtgcgcgcgaaatcctgacggaatggaaagacagccccgtctcatcgggcgtg
tacgttatacagggcgacgagaaaaaagatatcctgaaccggtatatcgacagctacacc
atcgaacgcgcccggcttttcgccgccggacacccgcattccaacctcgtccatatcgaa
tacgaccgcttcggcgaagaatacctgttcttcaccaaagactgggacaaactccaagcc
cgccgcctgcccagccccctgttgatccccggcctgccgctcgccccgatttggcacgaa
ctcatcatattgtccttcatcatcatcgtcggactgctgatggcgtacatcctcgccggc
aacattgccaaacccatcagaatcttaggcaacggcatggacagggtggcaaacggagaa
cttgaaacccgtatctcccaacaggtcgacgaccgcgacgacgaattgtcccatcttgcc
atccaattcgacaaaatggtggaaaaactcgaaaaactcgttgccaaagaacgccacctg
ctccatcacgtctcccatgaaatgcgttctccccttgcgcgcatgcaggcaattgtcgga
ctgattcaggcgcagccccaaaaacaggagcaatatctcaaacggctggaaggcgaactg
acccgcatggatacgctggccggggaactgttaaccctgtcccgtctcgaaacttccaat
atggctttggaaaaagaaagcctgaaactcctgcccttcctgggcaacctggtagaagac
aatcaaagcattgcccagaaaaacggacaaacggttaccctgtctgccgacggaaaaatc
cccgaaaacacaaccatccttgccaacgaaagctacctgtaccgcgccttcgacaacgtc
atccgcaacgccgtcaactacagtcccgaaggcagcaccatcctgatcaacatcggacaa
gaccacaaacactggataatcgacgttaccgacaacggccccggcgtggacgaaatgcag
ctcccgcacatcttcaccgctttctaccgtgcagactccagtgccaacaaacccggaaca
ggactggggcttgcattgacccaacatattattgaacagcactgcggcaaaatcatcgcc
gaaaacatcaaaccgaacggtctgcggatgcgctttatcctgcccaagaaaaaaaccggt
tccaaaacagaaaaaagtgcgaactga

DBGET integrated database retrieval system