KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_0899Help
Entry
NMA510612_0899    CDS       T03438                                 

Definition
(GenBank) hypothetical protein
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C_2 Wzy_C PglL_A TPR_2
Motif
Other DBs
NCBI-ProteinID: AHW75201
UniProt: X5EP18
LinkDB All DBs
Position
complement(792331..794145)
Genome map
AA seq 604 aa AA seqDB search
MPAETTVSGAHPAAKLPIYILPCFLWIGIVPFTFALRLQPSPDFYHDAAAAAGLIVLLFL
TAGKKLFDVKIPPISFLLFAMAAFWYLQARLMNLIYPGMNDIVSWIFILLAVSAWACRSL
VAHYGQERIVTLFAWSLLIGSLLQSCIVVIQFAGWEDTPLLQNIIVYSGQGVIGHIGQRN
NLGHYLMWGILAAAYLNGQRKIPAALGAICLIMQTAVLGLVNSRTILTYIAAIALILPFW
YFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRYETAVERVANGGFTDLPRQI
EWNKALTAFQSAPIFGHGWNSFAQQTFLINAEQHNIHDNLLSNLFTHSHNIVLQLLAEMG
ISGTLLVAATLLTGIAGLLKHPLTPASLFLICTLAVSMCHSMLEYPLWYVYFLIPFGLML
FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVHSFSPATDDSAKTLNRK
INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKALKYRPYSATYRIALYL
MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPEA
KPCK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgaaacgaccgtatccggcgcgcaccccgccgccaaactgccgatttacatc
ctgccctgcttcctttggataggcatcgtcccctttacctttgcgctcaggctgcaaccg
tcgcccgacttttaccacgatgccgccgccgcagccggcctgattgtcctgttgttcctc
acggcaggaaaaaagctgtttgatgtcaaaatcccacctatcagcttccttctgtttgca
atggcggcgttttggtatcttcaggcacgcctgatgaacctgatttaccccggtatgaac
gacatcgtctcttggattttcatcttgctcgccgtcagcgcgtgggcctgccggagcttg
gtcgcacactacggacaagaacgcatcgttaccctgtttgcctggtcactgcttatcggc
tccctgcttcaatcctgtatcgtcgtcatccagtttgccggctgggaagacacccccctg
cttcaaaacatcatcgtttacagcgggcaaggcgtaatcggacacatcgggcagcgcaac
aacctcggacactacctcatgtggggcatactcgccgccgcctacctcaacggacaacga
aaaatccccgccgccctcggcgcaatctgcctgattatgcagaccgccgttttaggtttg
gtcaattcgcgcaccatcttgacctacatagccgccatcgccctcatccttcccttctgg
tatttccgttcggacaaatccaacaggcggacgatgctcggcatagccgcagccgtattc
cttaccgcgctgttccaattttccatgaacaccattctggaaacctttaccggcatccgc
tacgaaactgccgtcgaacgcgtcgccaacggcggtttcacagacttgccgcgccaaatc
gaatggaataaagccctcaccgccttccagtccgccccgatattcgggcacggctggaac
agttttgcccaacaaaccttcctcatcaatgccgaacagcacaacatacacgacaacctc
ctcagcaacttgttcacccattcccacaacatcgtcctccaactccttgcagagatggga
atcagcggcacgcttctggttgccgcaaccctgctgacgggcattgccgggctgctgaaa
caccccctgacccctgcatcgcttttcctgatctgcacgcttgccgtcagtatgtgccac
agtatgctcgaatatcctttgtggtatgtctatttcctcatccccttcggactgatgctc
ttcctgtcccccgcagaggcttcagacggcatcgccttcaaaaaagccgccaacctcggc
atactgaccgcctccgccgccatattcgcaggattgctgcacttggactggacatacacc
cggctggttcactccttttcccccgccactgacgacagtgccaaaaccctcaaccgaaaa
atcaacgaactgcgctatatttctgcaaacagtccgatgctgtccttttatgccgacttc
tccctcgtaaacttcgccctgccggaataccccgaaacccagacttgggcggaagaagca
accctcaaagcactaaaataccgcccctactccgccacctaccgcatcgccctctacctg
atgcggcaaggcaaagttgcagaagcaaaacaatggatgcgagcgacacagtcctattac
ccctacctgatgccccgatacgccgacgaaatccgcaaactgcccgtatgggcgccgctg
ctgcccgaactgctcaaagactgcaaagccttcgccgccgcgcccggtcatccggaagca
aaaccctgcaaatga

DBGET integrated database retrieval system