KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_0906Help
Entry
NMA510612_0906    CDS       T03438                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00340  Histidine metabolism
nmx01100  Metabolic pathways
nmx01110  Biosynthesis of secondary metabolites
nmx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMA510612_0906 (hisE)
Enzymes [BR:nmx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     NMA510612_0906 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG GIT_SHD
Motif
Other DBs
NCBI-ProteinID: AHW75208
UniProt: X5F7S7
LinkDB All DBs
Position
complement(797278..797730)
Genome map
AA seq 150 aa AA seqDB search
MQQHKCRLKRSDGIFQRNATGVLPESSRLAYHSERTETNRRKIMGDSVLSAIQQTIIQRK
SADPSESYVAQLLHKGEDKILKKVIEEAGEVLMASKDKDPSQLVYEVADLWFHTMILLTH
HDLKAEDVLDELARRQGLSGLAEKAARTES
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacagcacaaatgccgtctgaaacgctcagacggcattttccaacgaaacgcaaca
ggcgtattgcccgagagcagccgtttagcctatcattccgaacgaacagaaacaaacaga
aggaaaatcatgggagattccgtactatccgccatccaacaaaccattatacagcgcaaa
tctgccgatccgtccgaatcttacgtcgcacagctcctgcataagggcgaagacaaaatc
ctaaaaaaagtgattgaagaggcgggcgaagtgttgatggcatccaaagacaaagacccg
tcccaactggtttacgaagttgccgacttatggtttcacaccatgattcttctgacacac
cacgacctgaaggcggaagacgtactggacgaacttgcgcgccgtcaaggtttgtcgggc
ttggccgaaaaagccgctcgcacagaatcttga

DBGET integrated database retrieval system