KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_1280Help
Entry
NMA510612_1280    CDS       T03438                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00020  Citrate cycle (TCA cycle)
nmx00190  Oxidative phosphorylation
nmx00650  Butanoate metabolism
nmx01100  Metabolic pathways
nmx01110  Biosynthesis of secondary metabolites
nmx01120  Microbial metabolism in diverse environments
nmx01130  Biosynthesis of antibiotics
nmx01200  Carbon metabolism
Module
nmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA510612_1280 (sdhA)
   00650 Butanoate metabolism
    NMA510612_1280 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMA510612_1280 (sdhA)
Enzymes [BR:nmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMA510612_1280 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NMA510612_1280 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AHW75570
UniProt: X5EIR4
LinkDB All DBs
Position
1102368..1104131
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDSQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREIMEIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattatccaaatccggtctgaattgtgccgttttgtctaaagtgttc
ccgacccgttcgcataccgtagcggcgcagggcggtatttccgcctctctgggtaatgtg
caggaagaccgttgggactggcacatgtacgataccgtgaaaggttccgactggttgggc
gaccaagatgcgattgagtttatgtgccgcgccgcgcctgaagccgtaattgagttggaa
cacatgggtatgccttttgaccgtgtggaaagcggtaaaatttatcagcgtcctttcggc
ggccatactgccgaacacggtaaacgcgcggtagaacgcgcctgtgcggttgccgaccgt
acaggtcatgcgatgctgcatactttgtaccaacaaaacgtccgtgccaatacgcaattc
tttgtggaatggacggcacaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaaccggcgaagtttatattttccacgctaaagctgtgatgttt
gctaccggcggcggcggccgtatttatgcgtcttctaccaatgcctatatgaataccggc
gatggtttgggtatttgtgcgcgtgcaggtatcccgttggaagacatggaattctggcaa
ttccacccgaccggcgtggcaggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaatgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgttgtttcccgcgcgatggcgatggaaatctacgaaggt
cgcggttgcggtaaaaacaaagaccatgtcttactgaaaatcgaccatatcggcgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagttcgctggtatcgat
ccgattaaagacccgattcccgttgtgccgactacccactatatgatgggcggcattccg
accaattaccacggcgaagtcgttgtgccgcaaggagacgaatacgaagtgcctgtaaaa
ggcctgtatgccgcaggtgagtgcgcctgtgcttccgtacacggtgcgaaccgtttgggt
acgaactccctgctggacttggtggtattcggtaaagctgccggcgacagcatgattaaa
ttcatcaaagagcaaagcgactggaaacctttgcctgctaatgctggtgagttgacccgc
caacgtatcgagcgtttggacagccaaaccgatggtgaaaacgttgatgcattgcgccgc
gaactgcaacgctctgtacaactgcacgccggtgtgttccgtaccgatgagattctgagc
aaaggcgttcgagaaattatggagattgccgagcgcgtgaaacgtaccgaaatcaaagac
aagagcaaagtgtggaataccgcgcgtatcgaggctttggaattggataacctgattgaa
gtggcgaaagcgactttggtgtctgccgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgcgatgatgaaaactggatgaaacatacgctgtaccattca
gataccaataccttgtcctacaaaccggtgcacaccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system