KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_1281Help
Entry
NMA510612_1281    CDS       T03438                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00020  Citrate cycle (TCA cycle)
nmx00190  Oxidative phosphorylation
nmx00650  Butanoate metabolism
nmx01100  Metabolic pathways
nmx01110  Biosynthesis of secondary metabolites
nmx01120  Microbial metabolism in diverse environments
nmx01130  Biosynthesis of antibiotics
nmx01200  Carbon metabolism
Module
nmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA510612_1281 (sdhB)
   00650 Butanoate metabolism
    NMA510612_1281 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMA510612_1281 (sdhB)
Enzymes [BR:nmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMA510612_1281 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NMA510612_1281 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_9 Fer4_7 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AHW75571
UniProt: X5EQ17
LinkDB All DBs
Position
1104251..1104958
Genome map
AA seq 235 aa AA seqDB search
MEKMSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLKAQDDTLSFRRSCREGIC
GSDGMNINGKNGLACLTDLRGLKQPVKIRPLPGLPVIRDLIVDMTQFFKQYHSVKPYVVN
DNPIDADKERLQTQEERKELDGLYECILCACCSTACPSFWWNPDKFVGPSGLLNAYRFIA
DSRDTITNERLDNLNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgagttttgaaatttaccgttacaacccggacgttgatgccaaaccttat
atgcagcgttacgagttggaattggaaccaaccgacgttaaacttttggacgctttagtg
cgcctgaaagcacaagatgatacattgtctttccgccgttcctgccgcgaagggatttgc
ggttctgacggtatgaacatcaacggcaaaaacggcttggcatgtttgaccgatctgcgt
ggcttgaaacagccggttaaaatccgtcctctgccaggtctgcctgttatccgcgacctg
attgtggatatgacccagttcttcaaacaataccattccgtcaaaccttatgttgtcaac
gataatccgattgatgcggacaaagagcgtctgcaaactcaggaagagcgtaaagagttg
gacggtttgtacgagtgtattttgtgcgcctgctgttcgactgcctgcccgtcattttgg
tggaaccctgataaattcgttggtccgtccggtttgctgaatgcttaccgtttcattgcg
gacagccgtgataccatcactaatgagcgtttggataatctgaacgacccataccgtttg
ttccgttgccacaccattatgaactgcgtagacgtatgtcctaaacacttgaatccgacc
cgagccatcggtaagattaaagagattatgttgaaacgggccgtttaa

DBGET integrated database retrieval system