KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_1284Help
Entry
NMA510612_1284    CDS       T03438                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00020  Citrate cycle (TCA cycle)
nmx00310  Lysine degradation
nmx00380  Tryptophan metabolism
nmx01100  Metabolic pathways
nmx01110  Biosynthesis of secondary metabolites
nmx01120  Microbial metabolism in diverse environments
nmx01130  Biosynthesis of antibiotics
nmx01200  Carbon metabolism
Module
nmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA510612_1284 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMA510612_1284 (sucA)
   00380 Tryptophan metabolism
    NMA510612_1284 (sucA)
Enzymes [BR:nmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NMA510612_1284 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AHW75574
UniProt: X5ERD1
LinkDB All DBs
Position
1106726..1109638
Genome map
AA seq 970 aa AA seqDB search
MSFQTASVQPSGRGLLPFVYILKKRAHAMMDEKLNFSYLFGSNAPYIEELYEAFLENPDA
VDEKWKQYFTDLSKQPGTVAVDVAHTPIRESFVTLAKKKIASAVAGGADEAMLKKQVSVL
RLISAYRIQGVGAAQLDPLKRIPPRDIEALDPKFHGLSDADMTLQFNMGEGDFANRGKLP
LSQIISNLKQTYCGHIALEYIYIPNTEERRWVRNYFESVLSTPHYNADQKRRILKEMTAA
ETLERYLHTKYVGQKRFGVEGGESAIAGLNYLIQNASKDGVEEVIIGMAHRGRLNVLVNI
LGKKPGDLFAEFEGRAEIKLPSGDVKYHMGFSSDIATPHGPMHVSLAFNPSHLEIVNPVV
EGSARAKQKRLGENGRDKVLPVLIHGDSAFIGLGVNQATFNLSKTRGYTTGGTVHIVINN
QIGFTTSDIRDTRSTVHCTDIAKMVSAPVIHVNGDDPERVCFAIQAALDYRKKFHKDIVI
DVVCYRKWGHNEGDDPTLTQPMMYKKVSQHPGARALYTEQLIAEGVLTQAEADGYIQAYR
DALDKGEHVEQTTLSNFQRTQIDWSKYQGKDWREHIETGLPAADIERLTEKFTAVPEGFA
LHPTAKRVIEARKAMASGKQAIDWGMAETLAYASLVTKGHGVRISGEDSGRGTFSHRHAV
LHDQKREKWDDGTYVPLRHMGEGMGEFLVIDSILNEEAVMAFEYGFACSAPDKLTIWEAQ
FGDFANGAQVTIDQFLSSGETKWGRLCGLTTILPHGYDGQGPEHSSARVERWLQLCSENN
MQVIMPSEASQMFHLLQRQVLGSYRKPLVIFMSKRLLRFKGAMSPLENFTEGSTFRPVIG
DTAERASNDSVKRVVLCAGQVYYDLEAGRAECKLEDDVAIVRVEQLYPFPYDEVKAELAK
YPNAKSVVWAQEEPKNQGAFYQIRHRIEDVISEEQKLSYAGRPSSASPAVGYSSKHIAQL
KQLVEDALAL
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcagacggcatcagttcagccgtcaggacgcggacttctaccctttgtttat
attttaaagaaaagagcgcacgccatgatggacgaaaaactcaatttctcttacctgttc
ggttcgaacgcaccttacattgaggaattgtacgaggcttttttggaaaaccccgatgcg
gttgatgaaaaatggaagcagtatttcaccgatttgagcaaacagccggggacggttgct
gtcgatgtcgcacacacaccgattcgcgaatcatttgttactttggcgaaaaagaaaatt
gcatctgccgttgcgggcggtgcggatgaggcaatgctgaaaaagcaagtcagcgtttta
cggctgatttctgcctatcgtatccaaggcgtgggtgcagcccaacttgatccgctcaaa
cgtatccccccgcgcgatattgaagccctcgatccgaaattccacggtctgtcagatgcc
gatatgacgcttcaattcaatatgggcgagggcgattttgccaatcgcggcaaactgcct
ttgtcccaaatcatcagcaacctcaaacaaacctactgcggccacatcgcattggaatat
atctatattcccaataccgaagagcgccgctgggtacgcaattattttgaaagcgtattg
tccacaccgcattacaatgccgatcaaaaacgccgtatcttgaaagagatgactgctgcc
gaaactttggaacgttatctgcataccaaatatgtcggtcagaaacgtttcggtgtcgaa
ggcggcgaaagcgcgattgccggtttgaactacctgattcaaaacgccagtaaagacggc
gtggaagaagtcatcatcggtatggcgcaccgtggccgtctgaatgttttggtgaacatt
ttgggcaaaaaacccggcgatttgtttgccgaatttgaaggtcgtgccgaaatcaaactg
cccagcggcgacgtgaaataccatatgggcttcagctccgatattgctaccccgcacggc
ccgatgcatgtttctttggcgttcaacccgtctcacttagaaatcgtcaacccggtggtg
gaaggttctgcgcgcgccaaacaaaaacgtttgggcgaaaacggccgcgacaaagtcttg
ccggtattgattcacggcgactccgcatttatcggtctgggagtcaaccaagcgacattc
aacctgtctaaaacgcgcggttataccaccggcggtacggttcatatcgtcatcaacaac
caaatcggctttaccacttccgatatccgcgatacccgttcaaccgtacactgtaccgat
atcgcaaaaatggtttccgccccggttatccatgtgaacggcgatgatcccgaacgcgtt
tgctttgctatccaagccgctttggattaccgcaaaaaattccataaagacatcgtgatt
gacgttgtctgctaccgtaaatggggtcacaacgagggcgatgatccgaccttgacccaa
ccgatgatgtacaaaaaagtatcgcaacacccgggtgcgcgtgctttgtacaccgagcaa
ctgattgccgaaggcgtgctaacccaagccgaggcagacggttacatccaagcctaccgt
gatgctttggacaaaggcgagcacgtcgagcaaacaacgttgagcaacttccaacgcacg
caaatcgactggagcaaataccaaggcaaagattggcgcgaacacatcgaaaccggtttg
cctgccgcagatattgaacgtctcactgagaagtttaccgccgtaccggaaggctttgcc
ctgcatccgactgcaaaacgtgtgattgaagcgcgtaaagccatggcatccggcaaacag
gccatagattggggtatggccgaaaccttggcatacgccagcctcgtaaccaaaggtcac
ggcgtgcgtatttccggtgaggactcgggacgcggtacgttctcgcaccgccacgccgta
ttgcacgatcaaaaacgcgaaaaatgggacgacggtacttatgttcccctgcgccatatg
ggcgaaggaatgggcgagttcctggttatcgactccatcttgaacgaagaggccgtgatg
gcgttcgagtacggctttgcctgctccgctcctgacaagctcaccatttgggaagctcaa
ttcggcgatttcgccaacggcgcgcaagtgacgattgatcaattcctgtcttcaggcgaa
accaaatggggtcgcttgtgcggtctgaccaccatcctgccgcacggttacgacggtcaa
ggccctgagcactcttctgcacgcgtagaacgttggttgcaactgtgttctgagaacaat
atgcaagtcatcatgccatctgaagcgtcgcaaatgttccacctcttgcaacgtcaagtc
ttaggttcataccgcaaaccgctggtgattttcatgtccaaacgcctgttgcgcttcaaa
ggtgcaatgagcccgctggaaaacttcaccgaaggttcgactttccgtccggttatcggt
gataccgccgaacgcgcaagcaacgacagcgtgaaacgcgtggtattgtgtgccggtcag
gtttactatgacttggaagccggtcgagccgaatgtaaactggaagatgatgttgcgatt
gttcgcgttgagcagctatatccgttcccatacgacgaggttaaagctgaactggcgaaa
tatccgaacgcaaaatctgtggtttgggcacaagaagagccgaaaaaccaaggcgcgttc
taccaaatccgccaccgcatcgaagacgttatcagcgaagagcaaaaactgtcttatgcc
ggtcgtccaagcagcgcatcgcctgcagtgggctactcaagcaaacacattgctcaattg
aaacaattggttgaagacgctttggcgttgtaa

DBGET integrated database retrieval system