KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_1285Help
Entry
NMA510612_1285    CDS       T03438                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00020  Citrate cycle (TCA cycle)
nmx00310  Lysine degradation
nmx00380  Tryptophan metabolism
nmx01100  Metabolic pathways
nmx01110  Biosynthesis of secondary metabolites
nmx01120  Microbial metabolism in diverse environments
nmx01130  Biosynthesis of antibiotics
nmx01200  Carbon metabolism
Module
nmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA510612_1285 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMA510612_1285 (sucB)
   00380 Tryptophan metabolism
    NMA510612_1285 (sucB)
Enzymes [BR:nmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMA510612_1285 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Neisseria_TspB
Motif
Other DBs
NCBI-ProteinID: AHW75575
UniProt: X5EIS0
LinkDB All DBs
Position
1109738..1110919
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAATAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVIVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgcatcgatacagctgct
actgccgctgctgaagcacctgcagccgctcctgccgaagcagccccggccgccgctcct
gccgccgcgcaaaacaacgccgctatgcctgccgccgccaaactggctgctgagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccactgctcctgctgttgcacttcctgcaggc
gcacgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgtctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaattg
ggctttatgtccttcttcgttaaagctgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgtggacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgcg
attggcagcccacgcggtttggttgtaccaatcctgcgtgatgccgaccaaatgagcatt
gccgacattgagcaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaacccacctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttattgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcatcgacggccgcgaagctgtattgactttggtagccattaaa
gacgcgttggaagacccagctcgcctgttgttggatctgtaa

DBGET integrated database retrieval system