KEGG   Neisseria meningitidis 510612 (serogroup A): NMA510612_2324Help
Entry
NMA510612_2324    CDS       T03438                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nmx  Neisseria meningitidis 510612  (serogroup A)
Pathway
nmx00473  D-Alanine metabolism
nmx00550  Peptidoglycan biosynthesis
nmx01100  Metabolic pathways
nmx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NMA510612_2324 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMA510612_2324 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NMA510612_2324 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmx01011]
    NMA510612_2324 (ddl)
Enzymes [BR:nmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NMA510612_2324 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:nmx01011]
 Precursor biosynthesis
  Amino acid ligase
   NMA510612_2324 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 RimK ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AHW76590
UniProt: X5ELL5
LinkDB All DBs
Position
complement(2010100..2010996)
Genome map
AA seq 298 aa AA seqDB search
MAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTAFNILHG
TYGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLHDDTDFD
AVEEKLGLPMFVKPAAEGSSVGVVKVKGKGRLKSVYEELKHFQGEIIAERFIGGGEYSCP
VLNGKGLPGIHIIPATEFYDYEAKYNRNDTIYQCPSEDLTEAEESLMRELAVRGAQAIGA
EGCVRVDFLKDTDGKLYLLEINTLPGMTGHSLVPKSAAVMGVGFADLCIEILKTAHVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtattgatgggcggtttttccagcgaacgagaaatctcgctggacagcggcacc
gccattttgaatgctttaaaaagcaaaggcatagacgcatacgccttcgatcccaaggaa
accccattgtctgaattgaaggcacaaggttttcagacggcattcaacatccttcacggt
acttacggcgaagacggggctgttcagggtgcattggaactgttgggcattccctatacc
ggcagcggtgtcgccgcatccgccatcggcatggacaaataccgctgcaaactgatttgg
caggcattgggattgcccgttcccgagttcgccgtcctgcacgacgacactgatttcgat
gccgtcgaagaaaaattgggcctgccgatgtttgtgaaaccggcggccgaaggcagcagc
gtaggcgtggtaaaagtcaaaggaaaaggccgtctgaaaagcgtttacgaagaattgaaa
cactttcagggcgaaatcattgccgaacggtttatcggcggcggcgaatattcctgccct
gtgttgaacggcaaaggcctgcccggcatacacatcatccccgcgaccgagttttatgac
tacgaagccaagtacaaccgcaacgacaccatttatcaatgtccttcggaagatctgacc
gaagccgaagaaagcctgatgcgcgaactggcggttcgcggcgcgcaggcaatcggtgcg
gaaggctgcgtgcgcgtcgatttcctcaaagataccgacggcaaactctatctgttggaa
atcaacaccctgcccggtatgaccggccatagtttagtaccgaaatccgctgccgttatg
ggcgtgggttttgccgatttatgtattgaaattttgaagaccgcacatgtgggataa

DBGET integrated database retrieval system