KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0233Help
Entry
NMBNZ0533_0233    CDS       T01949                                 

Gene name
glnE
Definition
(GenBank) glutamate-ammonia ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nmz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NMBNZ0533_0233 (glnE)
Enzymes [BR:nmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     NMBNZ0533_0233 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     NMBNZ0533_0233 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C
Motif
Other DBs
NCBI-ProteinID: ADZ02712
LinkDB All DBs
Position
233077..235767
Genome map
AA seq 896 aa AA seqDB search
MSDNRLDTARRHSLFLARQLDNGKLKPEIFLPMLDKVLTEADFQAFADWDKIRAEENEEE
LARQLRGLRRYVVSQIIVRDINRISDLNEVTRTITLFADFAVNTALDFSYAYYQDMYGTP
IGRYTKSPQHLSVVAMGKAGGYELNVSSDIDLIFIYPESGDTDGRRERGNQEFFTKVGQK
LIALLNDITADGQVFRVDMRLRPDGDSGALVLSETALEQYLITQGREWERYAWCKGRVVT
PYPNDIKSLVRPFVFRKYLDYGAYEAMRKLHRQIHSEVGKKGMADNIKLGAGGIREVEFI
AQIFQMIRGGQMRALQLKGTRETLEKLAESGIMPSENVETLLAAYRFLRDVEHRLQYWDD
RQTQTLPASPEQRQLLAESMGFDDYADFLNALNQHRNQVNRLFNEILSEPEEQTQSNSEW
QWVWQDKPDEEERQGRLKEHGFDAETIATRLDQIRHSHKYRHLSAHAQPRFDAVVPLFVQ
AAAAQSNPTDTLMRLLDFLENISRRSAYLAFLNEHPQTLAQLAQIMGQSSWVAAYLNKYP
ILLDELISAQLLDTAFDWQALAAALSDDLKACGGDTEAQMDTLRHFQHAQVFRLAVQDLA
GLWTVESLSDQLSALADTILAAALLCAWADMPKKHRDTPQFAVVGYGKLGGKELGYASDL
DLVYLYDDPHPEAGDVYSRLARRLTNWLSTATGAGSLYETDLRLRPNGDAGFLAHSIAAF
EKYQRENAWTWEHQSLTRARFICGTPEIQTAFDRIRTEILTAERDQTALADEIIEMREKM
FPTHPPADSNVKYARGGVVDVEFIVQYLILAHARKYPQLLDNYGNIALLNIATDCGLIDK
TLAEQSRTAYRFYRRQQHNTKLRDAEKTEVSGELLAHYGNVRKLWREVFGEEAATA
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaaccgcctcgacaccgcccgccgccattccctcttcctcgcccgccagctc
gacaacggcaaactcaagcccgaaattttcctgccgatgttggacaaggtgttgaccgaa
gcggatttccaagcctttgccgactgggacaaaatccgtgcggaagaaaacgaggaagaa
ttggcgcggcagttgcgcgggttgcgccgttatgtggtgtcgcagattatcgtgcgcgat
atcaaccgcatcagcgatttgaacgaagtaacccgcacgattacgctgtttgccgatttt
gctgtgaataccgcattggatttttcatacgcctattatcaggatatgtacggcacgccg
atcgggcgttataccaaatcgccgcagcatttgagcgtggtggcgatgggcaaggcgggc
ggctatgagttgaacgtgtcttccgacatcgatttaatttttatctaccccgaatcgggc
gataccgacggtaggcgcgaacgcggcaatcaggaatttttcaccaaagtcgggcagaaa
ctgattgcgttgctgaatgacattaccgccgacgggcaggtgttccgcgtcgatatgcgg
ctgcggccggacggcgattcgggcgcgctggtattgagcgaaaccgcgctggagcaatat
ttgattacgcaggggcgcgaatgggaacgctacgcgtggtgcaaaggccgcgtggtcacg
ccgtatccgaacgacatcaaatcgctggtgcgccccttcgtgttccgcaaatatctggat
tacggcgcgtatgaggcgatgcgtaagctgcaccgccaaatccacagcgaagtcggcaaa
aaagggatggcggacaacatcaaactcggcgcgggcggcatccgcgaagtcgaatttatc
gcccagattttccagatgatacgcggcgggcaaatgcgcgcgctgcaactgaaaggcacg
cgggaaacgctggaaaaactcgccgaatcgggcattatgccgtctgaaaacgtcgaaacc
ctgcttgccgcctaccgctttttgcgcgatgtcgaacatcgtttgcaatattgggacgac
cggcaaacccaaaccctgccggcttcgcccgaacagcggcaactgcttgccgaaagtatg
ggatttgatgattacgccgattttttgaatgctttaaatcaacatcggaaccaagtcaat
cggttgttcaacgaaattctgagcgaacccgaagaacaaacgcaaagcaacagcgaatgg
caatgggtttggcaggacaagcccgacgaagaagaacggcaaggccgtctgaaagaacac
gggtttgatgccgaaaccattgccacgcggctcgaccaaatccgccacagccataaatac
cgccacctctccgcacacgcccagccgcgtttcgatgcggttgtgccgctgttcgtacag
gcggcggcagcgcaaagcaacccgaccgatacattgatgcggctgttggattttctcgaa
aacatcagccgccgatccgcctatctcgccttcctcaacgaacatccgcaaaccttggcg
caactggcgcagattatgggccaaagttcttgggtggcggcgtatctgaacaaatatccg
attttgttggacgaactcatcagcgcgcagcttttggataccgcgtttgattggcaggcg
ctcgccgccgccctttcagacgacctcaaagcctgcggcggcgatactgaagcgcaaatg
gacaccctgcgccatttccaacacgcccaagtcttccgcctcgccgttcaagacctcgcc
ggactgtggacggtagaatccctctccgaccagctctccgcccttgccgacaccatcctc
gccgccgccctgctgtgcgcgtgggcggacatgcccaaaaaacaccgcgacaccccgcaa
tttgccgtcgtcggctacggcaagctcggcggcaaagaactcggctacgcctccgacctc
gacttggtctatctttacgacgatccccatcccgaagcaggcgacgtgtacagccgcctc
gcccgccgcctgaccaactggctttccaccgccaccggcgcaggcagcctctacgaaacc
gacctgcgcctgcgccccaacggcgacgcaggtttcctcgcgcacagcatcgccgccttt
gaaaaataccagcgcgaaaacgcgtggacgtgggaacaccagtcccttacccgcgcccgc
ttcatctgcggcacacccgaaattcagacggcattcgaccgcatccgcaccgaaatcctt
accgccgaacgcgaccaaaccgccttggcagacgaaatcatcgaaatgcgcgaaaaaatg
ttccccactcatcccccagccgacagcaacgtcaaatacgcacgcggcggcgtggttgat
gtcgaatttatcgtccaatatctgatacttgcccacgcccgaaaatatccgcaactcttg
gacaactacggcaacatcgccctcttgaacatcgccaccgactgtggcctcatcgacaaa
acccttgcagaacaaagccgcaccgcctaccgcttctaccgccggcagcaacacaatacc
aaactgcgcgacgcagaaaaaaccgaagtaagcggcgaattgctggcacattacggcaat
gtcaggaaattgtggcgggaagtgttcggcgaagaagcggcaaccgcctga

DBGET integrated database retrieval system