KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0514Help
Entry
NMBNZ0533_0514    CDS       T01949                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmz01100  Metabolic pathways
nmz01110  Biosynthesis of secondary metabolites
nmz01130  Biosynthesis of antibiotics
nmz01230  Biosynthesis of amino acids
Module
nmz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nmz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBNZ0533_0514 (aroK)
Enzymes [BR:nmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NMBNZ0533_0514 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 TsaE AAA AAA_22 PduV-EutP Cytidylate_kin AAA_5
Motif
Other DBs
NCBI-ProteinID: ADZ02975
LinkDB All DBs
Position
complement(552591..553103)
Genome map
AA seq 170 aa AA seqDB search
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPTIFEMEGEQGF
RSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYLHAPPETLLERTRCDNS
RPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQTLLKRLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttaacggcaaactcatcctcatcggactgatgggcgcgggcaaaaccacg
ctgggccggcaaatggcgcagcggctggattaccgtttttacgacagcgatcacgaaatc
gccgcagccgccggcgttcccatccccaccatatttgaaatggaaggcgaacagggattc
cgttcgcgcgaaaccgccatactcaaaaagctggttatcctgccccatatcgtcctgtcc
accggcggcggcgcggtgttaaaagaagaaaaccgcgcccttatccgcaaaagcggcacg
gtcgtctatctgcacgccccgcccgaaaccctgctcgaacgcacgcgctgcgacaacagc
cgtcctttgctgcaagttgccgatcctttggcgaaattacgtgaactctacgccgcacgc
gaccccgtttaccgccaaaccgccgactttaccgtagaatcggcaaactgccgggaaacc
gtgcaaaccctgctcaaacgcttatcccgataa

DBGET integrated database retrieval system