KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1836Help
Entry
NMBNZ0533_1836    CDS       T01949                                 

Gene name
penA
Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00550  Peptidoglycan biosynthesis
nmz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBNZ0533_1836 (penA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMBNZ0533_1836 (penA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmz01011]
    NMBNZ0533_1836 (penA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nmz03036]
    NMBNZ0533_1836 (penA)
Enzymes [BR:nmz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBNZ0533_1836 (penA)
Peptidoglycan biosynthesis and degradation proteins [BR:nmz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NMBNZ0533_1836 (penA)
Chromosome and associated proteins [BR:nmz03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    NMBNZ0533_1836 (penA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ADZ04223
LinkDB All DBs
Position
complement(1999586..2001331)
Genome map
AA seq 581 aa AA seqDB search
MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQ
GDNRIVRTQTLPATRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELVDV
PVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIG
FTDIDGKGQEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLD
QRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNR
AVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQ
KSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSF
GYGLQLSLLQLARAYTALTHDGVLLPVSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEP
GGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA
HGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaagagtgaatataagccccggatgctgcccaaagaagagcaggtcaaaaag
ccgatgaccagtaacggacggatcagcttcgtcctgatggcaatagcggtcttgtttgcc
ggtctgattgcccgcggactgtatctgcagacggtaacgtataactttttgaaagaacag
ggcgacaaccggattgtgcggactcaaacattgccggctacacgcggtacggtttcggac
cggaacggtgcggttttggcgttgagtgcgccgacggagtccctgtttgccgtgcctaaa
gagatgaaggaaatgccgtctgccgcacaattggaacgcctgtccgagcttgtcgatgtg
ccggttgatgttttgaggaacaagctcgaacagaaaggcaagtcgtttatctggattaag
cggcagctcgatcccaaggttgccgaagaggtcaaagccttgggtttggaaaactttgta
tttgaaaaagaattaaaacgccattacccgatgggcaacctgtttgcacacgtcatcgga
tttaccgatattgacggcaaaggtcaggaaggtttggaactttcgcttgaagacagcctg
catggcgaagacggcgcggaagtcgttttgcgggaccggcagggcaatattgtggacagc
ttggactccccgcgcaataaagccccgaaaaacggcaaagacatcatcctttccctcgat
cagaggattcagaccttggcctatgaagagttgaacaaggcggtcgaataccatcaggca
aaagccggaacggtggtggttttggatgcccgcacgggggaaatcctcgccttggccaat
acgcccgcctacgatcccaacaggcccggccgggcagacagcgaacagcggcgcaaccgt
gccgtaaccgatatgatcgaacccggttcggcaatcaaaccgtttgtgattgcgaaagca
ttggatgcgggcaaaaccgatttgaacgaacggctgaatacgcagccttataaaatcgga
ccgtctcccgtgcgcgatacccatgtttacccctctttggatgtgcgcggcatcatgcag
aaatcgtccaacgtcggcacaagcaaactgtctgcgcgtttcggtgccgaagaaatgtat
gacttctatcatgagttgggcatcggtgtgcgtatgcactcgggctttccgggcgaaact
gcaggtttgttgagaaattggcgcaggtggcggcccatcgaacaggcgacgatgtctttc
ggttacggcctgcaattgagcctgctgcaattggcgcgcgcctataccgcactgacgcac
gacggcgttttgctgccggtcagctttgaaaaacaggcggttgcgccgcaaggcaaacgc
atattcaaagaatcgaccgcgcgcgaggtacgcaatctgatggtttccgtgaccgagccg
ggcggcaccggtacggcgggtgcggtggacggtttcgatgtcggcgcgaaaaccggcacg
gcgcgcaagttcgtcaacgggcgttatgccgacaacaaacacatcgctacctttatcggt
tttgcccccgccaaaaacccccgtgtgattgtggcggtaaccattgacgaaccgactgcc
cacggttattacggcggcgtagtggcagggccgcccttcaaaaaaattatgggcggcagc
ctgaacatcttgggcatttccccgaccaagccactgaccgccgcagccgtcaaaacaccg
tcttaa

DBGET integrated database retrieval system